(data stored in ACNUC7421 zone)

EMBL: CP002116.PE350

CP002116.PE350       Location/Qualifiers
FT   CDS             362139..364037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0354"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.5.11"
FT                   /note="COGs: COG1894 NADH:ubiquinone oxidoreductase
FT                   NADH-binding (51 kD) subunit;
FT                   InterProIPR011538:IPR019554:IPR019575:IPR001450:IPR
FT                   017896:IPR017900:IPR001949; KEGG: dma:DMR_07840 putative
FT                   NAD-reducing hydrogenase subunit; PFAM: Respiratory-chain
FT                   NADH dehydrogenase domain 51 kDa subunit; Soluble ligand
FT                   binding domain; NADH ubiquinone oxidoreductase, F subunit,
FT                   iron sulphur binding; 4Fe-4S ferredoxin iron-sulfur binding
FT                   domain protein; PRIAM: NADH dehydrogenase (quinone); SPTR:
FT                   NADH dehydrogenase (Quinone); PFAM: NADH-ubiquinone
FT                   oxidoreductase-F iron-sulfur binding region; 4Fe-4S binding
FT                   domain; Respiratory-chain NADH dehydrogenase 24 Kd subunit;
FT                   Respiratory-chain NADH dehydrogenase 51 Kd subunit; SLBB
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79510"
FT                   /db_xref="GOA:E1RAY0"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAY0"
FT                   /protein_id="ADK79510.1"
FT                   /translation="MLKLNLEAVGTAYDHTVSSLRMRIIICAGTGCLAGGSLNIFHAFK
FT                   AEAQKHGVPLHVELKQEDNPEFLLSKSGCQGFCQVGPLVTIEPAGILYTKVTAEDVPEI
FT                   FETTILSGKTVERLLYVNPADGKRCSGPSDIPFYVRQSRSVLASCGLIDPENIREYIYG
FT                   GGYRAAMEAYTAHTPEELCTIFTDSGLRGRGGGGFPSGKKWALTLRQQADKKYLICNGD
FT                   EGDPGAFMDRSILEGNPHSVVEGMMIAARAIGAEAGYVYVRAEYPLAVERIRKAIDAAR
FT                   ELGLLGEDLFGTGACFDIKVMEGAGAFVCGEASAMVASIMGGRGMPRPKPPRTAEKGLW
FT                   DKPTVVNNVETLATVPLVLRKGSKGYRTVGTSGSPGTKTFALTGHVANTGLIEVPFGTT
FT                   LREIIFEIGGGVLDEKGNVDNDAFKAVQIGGPSGGCLTREHLDIPLDFDSLGGIGAMVG
FT                   SGGLVVMNRSTCMVQVARFFMQFTQAESCGKCVPCREGTRQMLDLLDDIIEGRADESTI
FT                   PLLESLCRTVARGSLCGLGKAAPSPVLSTLRYFRQEYESHVVDKRCPVGACKALSDFVI
FT                   DESLCKGCTACAKACPVGAISGEKKAPHTIDTERCIRCGACMATCRFGAIRRGGAA"
     MLKLNLEAVG TAYDHTVSSL RMRIIICAGT GCLAGGSLNI FHAFKAEAQK HGVPLHVELK        60
     QEDNPEFLLS KSGCQGFCQV GPLVTIEPAG ILYTKVTAED VPEIFETTIL SGKTVERLLY       120
     VNPADGKRCS GPSDIPFYVR QSRSVLASCG LIDPENIREY IYGGGYRAAM EAYTAHTPEE       180
     LCTIFTDSGL RGRGGGGFPS GKKWALTLRQ QADKKYLICN GDEGDPGAFM DRSILEGNPH       240
     SVVEGMMIAA RAIGAEAGYV YVRAEYPLAV ERIRKAIDAA RELGLLGEDL FGTGACFDIK       300
     VMEGAGAFVC GEASAMVASI MGGRGMPRPK PPRTAEKGLW DKPTVVNNVE TLATVPLVLR       360
     KGSKGYRTVG TSGSPGTKTF ALTGHVANTG LIEVPFGTTL REIIFEIGGG VLDEKGNVDN       420
     DAFKAVQIGG PSGGCLTREH LDIPLDFDSL GGIGAMVGSG GLVVMNRSTC MVQVARFFMQ       480
     FTQAESCGKC VPCREGTRQM LDLLDDIIEG RADESTIPLL ESLCRTVARG SLCGLGKAAP       540
     SPVLSTLRYF RQEYESHVVD KRCPVGACKA LSDFVIDESL CKGCTACAKA CPVGAISGEK       600
     KAPHTIDTER CIRCGACMAT CRFGAIRRGG AA                                     632
//

If you have problems or comments...

PBIL Back to PBIL home page