(data stored in ACNUC7421 zone)

EMBL: CP002116.PE356

CP002116.PE356       Location/Qualifiers
FT   CDS             complement(372572..373267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0360"
FT                   /product="ABC-type transport system, membrane protein"
FT                   /note="KEGG: dat:HRM2_32600 predicted ABC-type transport
FT                   system, membrane protein; SPTR: Predicted ABC-type
FT                   transport system, membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79516"
FT                   /db_xref="GOA:E1RAY6"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAY6"
FT                   /protein_id="ADK79516.1"
FT                   /translation="MISMTKRELYSLFGGPIAYIVIALFLLFSGMLFFPTFFIYDQAEM
FT                   RGFFQLLPILFSFFVPAITMRSFAEERSTGTFEALVSFPVSSGKIVLSKFFAAVIFIAV
FT                   MLAPTLLYVVLISLVGDPDPGPIIGGYVGALLLGAAYAAVGLFASSMTSNQIVAFIVTA
FT                   AIALLFTFFDQMLVLVPAALVNTLEFLGTQYHFRTIARGLLDSRSLIYLISLTAVFLLF
FT                   TVKAVRERR"
     MISMTKRELY SLFGGPIAYI VIALFLLFSG MLFFPTFFIY DQAEMRGFFQ LLPILFSFFV        60
     PAITMRSFAE ERSTGTFEAL VSFPVSSGKI VLSKFFAAVI FIAVMLAPTL LYVVLISLVG       120
     DPDPGPIIGG YVGALLLGAA YAAVGLFASS MTSNQIVAFI VTAAIALLFT FFDQMLVLVP       180
     AALVNTLEFL GTQYHFRTIA RGLLDSRSLI YLISLTAVFL LFTVKAVRER R                231
//

If you have problems or comments...

PBIL Back to PBIL home page