(data stored in ACNUC7421 zone)

EMBL: CP002116.PE361

CP002116.PE361       Location/Qualifiers
FT   CDS             377436..378983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0365"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG0488 ATPase components of ABC transporter
FT                   with duplicated ATPase domains; InterPro
FT                   IPR003593:IPR003439:IPR017871; KEGG: glo:Glov_0246 ABC
FT                   transporter related; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: ABC transporter related; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79521"
FT                   /db_xref="GOA:E1RAZ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAZ1"
FT                   /protein_id="ADK79521.1"
FT                   /translation="MVFNQLQISALSFSWPGMVEPLFTDLSFSIGAGWTGLVGANGSGK
FT                   STILSIITGENQPDSGSVKAPSRMLLCRQDTARLPDQADSFFYAFDERSEEIMRRLDIQ
FT                   YEWFFRWDSLSFGERKRVQIGTALYTAPDLLALDEPTNHLDEVSRDRLLSALADYEGIG
FT                   IIVSHDRYLLDCLCERTLFLRNGTVVLRPGGITVGLEEAAREAEEAKRALRTAQSRMHS
FT                   LQRDLERRRGVAREQQKRRSKAGLPIKDHDARFKKNLARLTGKDGTGGKLLRQLDGTLA
FT                   AASRTEETAKARLDDATMRKASGLTLGGELSGKDRLFMFGPDELQVGNRQLSYPELELR
FT                   PGERVAITGANGNGKSTLIHLLVEHFFLPNQDERFPWFYRNAVFLPQELSEADRRLCAD
FT                   LVASLDPSERGMLISAVHRLGSEVEGVLHSSLLSPGEARKVIIARASLMETEVLILDEP
FT                   TNHLDIESILLLEDALKKFSGALLLVSHDRRFREALTDREWKIYQEAPGRLVLSDEP"
     MVFNQLQISA LSFSWPGMVE PLFTDLSFSI GAGWTGLVGA NGSGKSTILS IITGENQPDS        60
     GSVKAPSRML LCRQDTARLP DQADSFFYAF DERSEEIMRR LDIQYEWFFR WDSLSFGERK       120
     RVQIGTALYT APDLLALDEP TNHLDEVSRD RLLSALADYE GIGIIVSHDR YLLDCLCERT       180
     LFLRNGTVVL RPGGITVGLE EAAREAEEAK RALRTAQSRM HSLQRDLERR RGVAREQQKR       240
     RSKAGLPIKD HDARFKKNLA RLTGKDGTGG KLLRQLDGTL AAASRTEETA KARLDDATMR       300
     KASGLTLGGE LSGKDRLFMF GPDELQVGNR QLSYPELELR PGERVAITGA NGNGKSTLIH       360
     LLVEHFFLPN QDERFPWFYR NAVFLPQELS EADRRLCADL VASLDPSERG MLISAVHRLG       420
     SEVEGVLHSS LLSPGEARKV IIARASLMET EVLILDEPTN HLDIESILLL EDALKKFSGA       480
     LLLVSHDRRF REALTDREWK IYQEAPGRLV LSDEP                                  515
//

If you have problems or comments...

PBIL Back to PBIL home page