(data stored in ACNUC7421 zone)

EMBL: CP002116.PE362

CP002116.PE362       Location/Qualifiers
FT   CDS             complement(378980..380527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0366"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterPro IPR003660:IPR004089:IPR004090:IPR013163; KEGG:
FT                   afw:Anae109_2874 methyl-accepting chemotaxis sensory
FT                   transducer; PFAM: chemotaxis sensory transducer; Cache type
FT                   2 domain protein; histidine kinase HAMP region domain
FT                   protein; SMART: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SPTR: Methyl-accepting
FT                   chemotaxis sensory transducer with Cache sensor; PFAM:
FT                   Cache domain; HAMP domain; Methyl-accepting chemotaxis
FT                   protein (MCP) signaling domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79522"
FT                   /db_xref="GOA:E1RAZ2"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAZ2"
FT                   /protein_id="ADK79522.1"
FT                   /translation="MKKQSFAWKLIIIVSTLLLISLLISDILFIRTFRTSIYQEKRESL
FT                   TRLVDAAMGIINYAAEKETSGALSREDAQDMAKELLAHFTYGKDRMDYFWINNMQQIMV
FT                   MHPYRPELDGTDISGLKDPTGVPIFQKMVDVVNQSGKGFVEYSWQYYNEKGRIEPKLSY
FT                   VADFKPWGWIIGTGIYIDDIEKTIIAIATRIAGVTIIFLLVAIIFIYLISRAMAGPLVR
FT                   FATIAKDIAEGDLLVDVPTLKRNDELGTLASALGQMVEQVGNIILEVQEAAAQVRIGSD
FT                   QVNYSAQDLSRGTTEQASSMEEISSSIEEMVANMRQTAKNAKATDSIAQKAATSAGESG
FT                   KAVGKTVEAMNAIAEKVSLIEEIARQTNMLSLNAAIEAARAGESGKGFAVVAAEVRKLA
FT                   ERSRYAANQIGELIESSVRIAEQAGTAIDDLVPEIMNTSKLVREISAATEEQENSASQI
FT                   GKGVEQLDRIVQDNAAASEELAASAEELSAQAEQMHAATDYFQVDRNDAIEEEQEED"
     MKKQSFAWKL IIIVSTLLLI SLLISDILFI RTFRTSIYQE KRESLTRLVD AAMGIINYAA        60
     EKETSGALSR EDAQDMAKEL LAHFTYGKDR MDYFWINNMQ QIMVMHPYRP ELDGTDISGL       120
     KDPTGVPIFQ KMVDVVNQSG KGFVEYSWQY YNEKGRIEPK LSYVADFKPW GWIIGTGIYI       180
     DDIEKTIIAI ATRIAGVTII FLLVAIIFIY LISRAMAGPL VRFATIAKDI AEGDLLVDVP       240
     TLKRNDELGT LASALGQMVE QVGNIILEVQ EAAAQVRIGS DQVNYSAQDL SRGTTEQASS       300
     MEEISSSIEE MVANMRQTAK NAKATDSIAQ KAATSAGESG KAVGKTVEAM NAIAEKVSLI       360
     EEIARQTNML SLNAAIEAAR AGESGKGFAV VAAEVRKLAE RSRYAANQIG ELIESSVRIA       420
     EQAGTAIDDL VPEIMNTSKL VREISAATEE QENSASQIGK GVEQLDRIVQ DNAAASEELA       480
     ASAEELSAQA EQMHAATDYF QVDRNDAIEE EQEED                                  515
//

If you have problems or comments...

PBIL Back to PBIL home page