(data stored in ACNUC7421 zone)

EMBL: CP002116.PE366

CP002116.PE366       Location/Qualifiers
FT   CDS             383074..384642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0370"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="COGs: COG2199 FOG: GGDEF domain; InterPro
FT                   IPR000160:IPR013656:IPR000014; KEGG: dae:Dtox_1677
FT                   diguanylate cyclase with PAS/PAC sensor; PFAM: GGDEF domain
FT                   containing protein; PAS fold-4 domain protein; PRIAM:
FT                   Diguanylate kinase; SMART: GGDEF domain containing protein;
FT                   SPTR: Diguanylate cyclase with PAS/PAC sensor; TIGRFAM:
FT                   diguanylate cyclase; PAS sensor protein; PFAM: GGDEF
FT                   domain; PAS fold; TIGRFAM: PAS domain S-box; diguanylate
FT                   cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79526"
FT                   /db_xref="GOA:E1RAZ6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR031621"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAZ6"
FT                   /protein_id="ADK79526.1"
FT                   /translation="MRIGIISILLFLSSTILLSLTVPAWSHRDRALGKSFIALCLSIAI
FT                   YNLGYGMELASTNLTTLIVWSKFQYLGIPFIPTFFFLFAANYTGIRDRIPLPLVFYLVG
FT                   FPCITMVLHLTQEHHNLMYINPTIHRVWNLSFLAFDKGLWYKISRWHVAIIISAGAILF
FT                   LRFFLRSVAVFRRQSVLILIGALFPWAGWLVYMLDILPSGFDPTPFALFLASLFLATAL
FT                   LRYRLFDVSPIAKEQVFESIDTGVLVLDSEKRLVDYNHAAYLVFPALKKEMKGVHGEDL
FT                   FKNITSGNRLFEESDSGDVSVDIQIASDDSLRHYWARRSSIRTPKGRVLGSLILLDDIT
FT                   NRVRLLEKMETLASKDPLTGISNRRHLSSFGEKEVMRAFHYGTNLALIMFDLDLFKKVN
FT                   DTYGHDVGDQLLIHIVEIARGLVREADLLGRYGGEEFVILLPQTSLSDAQLIAERIRSS
FT                   IEISPLALESGTSIPMTASFGVTSSLGSSDFSFESLCKKADEALYRAKAEGRNQVVTFL
FT                   ETDNE"
     MRIGIISILL FLSSTILLSL TVPAWSHRDR ALGKSFIALC LSIAIYNLGY GMELASTNLT        60
     TLIVWSKFQY LGIPFIPTFF FLFAANYTGI RDRIPLPLVF YLVGFPCITM VLHLTQEHHN       120
     LMYINPTIHR VWNLSFLAFD KGLWYKISRW HVAIIISAGA ILFLRFFLRS VAVFRRQSVL       180
     ILIGALFPWA GWLVYMLDIL PSGFDPTPFA LFLASLFLAT ALLRYRLFDV SPIAKEQVFE       240
     SIDTGVLVLD SEKRLVDYNH AAYLVFPALK KEMKGVHGED LFKNITSGNR LFEESDSGDV       300
     SVDIQIASDD SLRHYWARRS SIRTPKGRVL GSLILLDDIT NRVRLLEKME TLASKDPLTG       360
     ISNRRHLSSF GEKEVMRAFH YGTNLALIMF DLDLFKKVND TYGHDVGDQL LIHIVEIARG       420
     LVREADLLGR YGGEEFVILL PQTSLSDAQL IAERIRSSIE ISPLALESGT SIPMTASFGV       480
     TSSLGSSDFS FESLCKKADE ALYRAKAEGR NQVVTFLETD NE                          522
//

If you have problems or comments...

PBIL Back to PBIL home page