(data stored in ACNUC7421 zone)

EMBL: CP002116.PE37

CP002116.PE37        Location/Qualifiers
FT   CDS             36136..37101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0037"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="COGs: COG0845 Membrane-fusion protein; InterPro
FT                   IPR006143; KEGG: btu:BT0141 acriflavin resistance
FT                   periplasmic protein; PFAM: secretion protein HlyD family
FT                   protein; SPTR: Acriflavin resistance periplasmic protein;
FT                   TIGRFAM: efflux transporter, RND family, MFP subunit; PFAM:
FT                   Biotin-requiring enzyme; TIGRFAM: RND family efflux
FT                   transporter, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79197"
FT                   /db_xref="GOA:E1R6R5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6R5"
FT                   /protein_id="ADK79197.1"
FT                   /translation="MNRKTAGLLLMLFALLIFVTGCDKLPGRGNKENATEAGSEKDADE
FT                   NTETVFAVSVTEAVTGQIYNYLNVNGDVVSKTTVDTYPDVAGKVSRILVAVGDTVRKNQ
FT                   VVAEVDPSKPGMNYAASPVKAAITGTITSIPVEVGSMVSQQSPIVRISRMDELQIKTYV
FT                   AERFISRMKLGQQALVSLDAFPGKTFMAKVVELSPMVDASSRTMDLKLDFVGSTDGVRA
FT                   GMFAKIKIITEDKEGVVKIPSAAVIERFGEDYVFVIKDESSVERRKVTAGIEIDGKQEI
FT                   LEGLSGGETTVIRGQTLLEDGSLVKVVQKVEPLPVKDSID"
     MNRKTAGLLL MLFALLIFVT GCDKLPGRGN KENATEAGSE KDADENTETV FAVSVTEAVT        60
     GQIYNYLNVN GDVVSKTTVD TYPDVAGKVS RILVAVGDTV RKNQVVAEVD PSKPGMNYAA       120
     SPVKAAITGT ITSIPVEVGS MVSQQSPIVR ISRMDELQIK TYVAERFISR MKLGQQALVS       180
     LDAFPGKTFM AKVVELSPMV DASSRTMDLK LDFVGSTDGV RAGMFAKIKI ITEDKEGVVK       240
     IPSAAVIERF GEDYVFVIKD ESSVERRKVT AGIEIDGKQE ILEGLSGGET TVIRGQTLLE       300
     DGSLVKVVQK VEPLPVKDSI D                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page