(data stored in ACNUC7421 zone)

EMBL: CP002116.PE371

CP002116.PE371       Location/Qualifiers
FT   CDS             389731..390612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0375"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1175 ABC-type sugar transport systems
FT                   permease components; InterPro IPR000515; KEGG:
FT                   rec:RHECIAT_PC0000130 probable sugar ABC transporter,
FT                   permease protein; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; SPTR: Transport protein;
FT                   PFAM: Binding-protein-dependent transport system inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79531"
FT                   /db_xref="GOA:E1RB01"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB01"
FT                   /protein_id="ADK79531.1"
FT                   /translation="MMLFKQREYLKYLLPALIVLALINIFPTFFLYIISLTNYDISQRV
FT                   EDLSFVGLENYRYLFSIDKDFWKSIYITLTYTFVSVTVELVLGSAIALLFDANTRFRKL
FT                   KLSLFIIPMIATPSIIALMWKLILNAEYGVLNTFLRWMGCAGRNWLSTDFALVSLILID
FT                   IWQWTPYVTLMIYSGLQTVPQEPLEAADVDGASWFQKLVWIVLPHISTIVSITLLLKLI
FT                   ENLKSFDIVYNLTQGGPGNATELLSLHVFRLGFKQTHWLGRASACAVILLLIIIPIVSN
FT                   LAKKISYSRESA"
     MMLFKQREYL KYLLPALIVL ALINIFPTFF LYIISLTNYD ISQRVEDLSF VGLENYRYLF        60
     SIDKDFWKSI YITLTYTFVS VTVELVLGSA IALLFDANTR FRKLKLSLFI IPMIATPSII       120
     ALMWKLILNA EYGVLNTFLR WMGCAGRNWL STDFALVSLI LIDIWQWTPY VTLMIYSGLQ       180
     TVPQEPLEAA DVDGASWFQK LVWIVLPHIS TIVSITLLLK LIENLKSFDI VYNLTQGGPG       240
     NATELLSLHV FRLGFKQTHW LGRASACAVI LLLIIIPIVS NLAKKISYSR ESA              293
//

If you have problems or comments...

PBIL Back to PBIL home page