(data stored in ACNUC7421 zone)

EMBL: CP002116.PE372

CP002116.PE372       Location/Qualifiers
FT   CDS             390609..391421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0376"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG0395 ABC-type sugar transport system
FT                   permease component; InterPro IPR000515; KEGG: pmo:Pmob_0307
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; SPTR: Transport protein;
FT                   PFAM: Binding-protein-dependent transport system inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79532"
FT                   /db_xref="GOA:E1RB02"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB02"
FT                   /protein_id="ADK79532.1"
FT                   /translation="MKRKTSPIIPVVTWIIILAALAPVLWMLLISFKQRVDIISFSVLF
FT                   KPTLENYKTVFQKYDFLRFILNSTIVVVATTAISVFLGTLAAYGLARFQFKKKESLAFG
FT                   ILSLRMLPPMAVVIPFFIMARYTHLLDTQLLLIIVYLGFNIPFTIWMMRGFIEDVSLSI
FT                   EESAWLDGCTRLEGFCKVVFPSIFPGLAATSIFCFIQSWNEFALAFFLTSFNSRTVPTI
FT                   VNSFISVLGVLWGEMAAVGVVSILPIVIFTMFVQKYLVKGLTMGAIKG"
     MKRKTSPIIP VVTWIIILAA LAPVLWMLLI SFKQRVDIIS FSVLFKPTLE NYKTVFQKYD        60
     FLRFILNSTI VVVATTAISV FLGTLAAYGL ARFQFKKKES LAFGILSLRM LPPMAVVIPF       120
     FIMARYTHLL DTQLLLIIVY LGFNIPFTIW MMRGFIEDVS LSIEESAWLD GCTRLEGFCK       180
     VVFPSIFPGL AATSIFCFIQ SWNEFALAFF LTSFNSRTVP TIVNSFISVL GVLWGEMAAV       240
     GVVSILPIVI FTMFVQKYLV KGLTMGAIKG                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page