(data stored in ACNUC7421 zone)

EMBL: CP002116.PE38

CP002116.PE38        Location/Qualifiers
FT   CDS             37116..40325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0038"
FT                   /product="acriflavin resistance protein"
FT                   /note="COGs: COG0841 Cation/multidrug efflux pump; InterPro
FT                   IPR001036; KEGG: bdu:BDU_143 acriflavine resistance
FT                   protein; PFAM: acriflavin resistance protein; SPTR:
FT                   Acriflavine resistance protein; PFAM: AcrB/AcrD/AcrF
FT                   family; TIGRFAM: heavy metal efflux pump
FT                   (cobalt-zinc-cadmium); The (Largely Gram-negative
FT                   Bacterial) Hydrophobe/Amphiphile Efflux-1 (HAE1) Family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79198"
FT                   /db_xref="GOA:E1R6R6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6R6"
FT                   /protein_id="ADK79198.1"
FT                   /translation="MSVSKTVVGKPTTILIIFLLLIGLGIYSTSDLAIDLYPEIEPPVL
FT                   VVFTGYDGAGPEEIEKRITRTLEGSLSNVSNIESITSTSSEGSSMIMVEFTWGTDMAEA
FT                   ANSVRDNLEFVKGALPDEADSPMIFKFDPSMIPIMGLTLSGNRTPEELRQIAEDVVQPK
FT                   IEQIEGVALTSVSGGRERIIRVEIPQDRLEAYDLTLTQISSMLQGQNVQVTAGNIDEGN
FT                   INYLVTTSGEYDSIDQIKNTVISYKNEGMPGTSGDGSTQRTVRLRDIADVYDGYKDADS
FT                   LVYINGEPGIQIIIQKQSGTNSVQTADNIRNRLERINKQVPEGITVTEIFNTTDIIKSS
FT                   LNQVSSSAITGALLAIIVLFVFLRSLKSTFIIGLTIPVSLIVTLMLMYFFGLTLNIMTL
FT                   AGLALGVGMLVDNSIVILENIYRYREKGAKLTASAILGSQEMINAIVASTLTTICVFAP
FT                   VVLFKSQLDVVGELLASLAFTVVISLSASLVVAVTLIPVLSSHYLPLTSRRQRPLRGTL
FT                   KALDGVMERFFQGLENLYASILRGVLRHKIITIVVVLAVFLSSLTLIPKTGFEFMPSMQ
FT                   EDQVNLGVELPVGTKLEITETVIKQMEDIVRSEVKGYDDIITEVGEASFFGLGGSAIGY
FT                   KGSIRIMLPPYKERIDSSDDVKQKLRKHFNDFPSAVFSFDSSQGASFGGTTPIDILIKT
FT                   EDLTKAKDIAEKIRDILQNMPEVTEPQIDLKDGLPQVEIVMDRDKMYSLGLNVYSVGQE
FT                   IQANLDGITASQFREGGNEYDIVMFLADEDRNQILDLNKVFVNNQAGQRIPLASFARYQ
FT                   KGTGPITINRENQTRVVHVTAGTVPGTALNEVADRAQQLINQEIPADEDVLIEFSGDYE
FT                   DLQKYGMRFVAIILVSVFLVFGVMASQFESFVDPFIILFAIPLSMIGVILIYFLTGQIF
FT                   NILTAVGLVMLAGIIVNNGIVLVDYTNLLRKRGMNIHDACVEAGRNRLRPILMTTLTTV
FT                   LGLVPMAFFPGEGSELVQPIGKSVVGGLSVGSLFTLLLIPVIYAIVNRVGERRQEKREA
FT                   RKLARQKNRLEIEAQCKGDEA"
     MSVSKTVVGK PTTILIIFLL LIGLGIYSTS DLAIDLYPEI EPPVLVVFTG YDGAGPEEIE        60
     KRITRTLEGS LSNVSNIESI TSTSSEGSSM IMVEFTWGTD MAEAANSVRD NLEFVKGALP       120
     DEADSPMIFK FDPSMIPIMG LTLSGNRTPE ELRQIAEDVV QPKIEQIEGV ALTSVSGGRE       180
     RIIRVEIPQD RLEAYDLTLT QISSMLQGQN VQVTAGNIDE GNINYLVTTS GEYDSIDQIK       240
     NTVISYKNEG MPGTSGDGST QRTVRLRDIA DVYDGYKDAD SLVYINGEPG IQIIIQKQSG       300
     TNSVQTADNI RNRLERINKQ VPEGITVTEI FNTTDIIKSS LNQVSSSAIT GALLAIIVLF       360
     VFLRSLKSTF IIGLTIPVSL IVTLMLMYFF GLTLNIMTLA GLALGVGMLV DNSIVILENI       420
     YRYREKGAKL TASAILGSQE MINAIVASTL TTICVFAPVV LFKSQLDVVG ELLASLAFTV       480
     VISLSASLVV AVTLIPVLSS HYLPLTSRRQ RPLRGTLKAL DGVMERFFQG LENLYASILR       540
     GVLRHKIITI VVVLAVFLSS LTLIPKTGFE FMPSMQEDQV NLGVELPVGT KLEITETVIK       600
     QMEDIVRSEV KGYDDIITEV GEASFFGLGG SAIGYKGSIR IMLPPYKERI DSSDDVKQKL       660
     RKHFNDFPSA VFSFDSSQGA SFGGTTPIDI LIKTEDLTKA KDIAEKIRDI LQNMPEVTEP       720
     QIDLKDGLPQ VEIVMDRDKM YSLGLNVYSV GQEIQANLDG ITASQFREGG NEYDIVMFLA       780
     DEDRNQILDL NKVFVNNQAG QRIPLASFAR YQKGTGPITI NRENQTRVVH VTAGTVPGTA       840
     LNEVADRAQQ LINQEIPADE DVLIEFSGDY EDLQKYGMRF VAIILVSVFL VFGVMASQFE       900
     SFVDPFIILF AIPLSMIGVI LIYFLTGQIF NILTAVGLVM LAGIIVNNGI VLVDYTNLLR       960
     KRGMNIHDAC VEAGRNRLRP ILMTTLTTVL GLVPMAFFPG EGSELVQPIG KSVVGGLSVG      1020
     SLFTLLLIPV IYAIVNRVGE RRQEKREARK LARQKNRLEI EAQCKGDEA                  1069
//

If you have problems or comments...

PBIL Back to PBIL home page