(data stored in ACNUC7421 zone)

EMBL: CP002116.PE384

CP002116.PE384       Location/Qualifiers
FT   CDS             405193..405876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0389"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sth:STH282 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79544"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB14"
FT                   /protein_id="ADK79544.1"
FT                   /translation="MIEAILNKKIRQNKRYWEDVIFSSVFGMLKYLNKGILYDVLKNAK
FT                   TLNEKENKFYYLKDQLNFIDSDNINYEFWKHLQLKDCKRCEPDLIIEGPNSIVCIEAKY
FT                   KSGKSSKKDNSNVPNDQLAKEYDNLSYYKGKKQLYLIYLTSSLRYPIEDIKESIDEYNN
FT                   KRKLPITIYWLNWNKIYCQLDKCRHNKRIIDDICLVLEYFYLDYFTHFKISSDKEYKRI
FT                   DWRFR"
     MIEAILNKKI RQNKRYWEDV IFSSVFGMLK YLNKGILYDV LKNAKTLNEK ENKFYYLKDQ        60
     LNFIDSDNIN YEFWKHLQLK DCKRCEPDLI IEGPNSIVCI EAKYKSGKSS KKDNSNVPND       120
     QLAKEYDNLS YYKGKKQLYL IYLTSSLRYP IEDIKESIDE YNNKRKLPIT IYWLNWNKIY       180
     CQLDKCRHNK RIIDDICLVL EYFYLDYFTH FKISSDKEYK RIDWRFR                     227
//

If you have problems or comments...

PBIL Back to PBIL home page