(data stored in ACNUC7421 zone)

EMBL: CP002116.PE385

CP002116.PE385       Location/Qualifiers
FT   CDS             405873..406436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0390"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pcb:PC000842.02.0 structural maintenance of
FT                   chromosome protein; SPTR: Putative uncharacterized protein
FT                   PY06369"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79545"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB15"
FT                   /protein_id="ADK79545.1"
FT                   /translation="MNDVIGIVENIEQMKSILMSLKKMTKYIINDFEEKNWELLEEKYI
FT                   SDCMPNKRKANYEEQFDLLFSMPTELFHVFKYRSRNKKFFPFINIFLNSINNINQPVVI
FT                   YGKFIPKDKVKKDKYWEEFQYDASKLILNNAIEKTSGGIILVDDLTEEEKNEFYYIKKI
FT                   EYRIINLFEVDNEILSKLIKEITT"
     MNDVIGIVEN IEQMKSILMS LKKMTKYIIN DFEEKNWELL EEKYISDCMP NKRKANYEEQ        60
     FDLLFSMPTE LFHVFKYRSR NKKFFPFINI FLNSINNINQ PVVIYGKFIP KDKVKKDKYW       120
     EEFQYDASKL ILNNAIEKTS GGIILVDDLT EEEKNEFYYI KKIEYRIINL FEVDNEILSK       180
     LIKEITT                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page