(data stored in ACNUC7421 zone)

EMBL: CP002116.PE388

CP002116.PE388       Location/Qualifiers
FT   CDS             410187..410729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0393"
FT                   /product="Domain of unknown function DUF1863"
FT                   /note="InterPro IPR015032; KEGG: sun:SUN_2116 hypothetical
FT                   protein; PFAM: Domain of unknown function DUF1863; SPTR:
FT                   Putative uncharacterized protein; PFAM: MTH538 TIR-like
FT                   domain (DUF1863)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79548"
FT                   /db_xref="InterPro:IPR015032"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB18"
FT                   /protein_id="ADK79548.1"
FT                   /translation="MSRHRVFISYHHLNDQQYKNQLEGIFRSSYEVALSNSVQIGDLNP
FT                   NLPSDRLRQLIRDKYIRDATVTIVLIGTETWKRRHVDWEIGSSIRKTEYNSRCGLIGLL
FT                   LPTRSDYYRDSFYPYTIPPRLYLNAKNGYAKIYNWTTNFMNLKYWIDEAFDRRNVIIPD
FT                   NSFPNFVNNRSGDRWYE"
     MSRHRVFISY HHLNDQQYKN QLEGIFRSSY EVALSNSVQI GDLNPNLPSD RLRQLIRDKY        60
     IRDATVTIVL IGTETWKRRH VDWEIGSSIR KTEYNSRCGL IGLLLPTRSD YYRDSFYPYT       120
     IPPRLYLNAK NGYAKIYNWT TNFMNLKYWI DEAFDRRNVI IPDNSFPNFV NNRSGDRWYE       180
//

If you have problems or comments...

PBIL Back to PBIL home page