(data stored in ACNUC7421 zone)

EMBL: CP002116.PE39

CP002116.PE39        Location/Qualifiers
FT   CDS             40322..40618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0039"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bre:BRE_141 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79199"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6R7"
FT                   /protein_id="ADK79199.1"
FT                   /translation="MKLLRVEIIANRSIEEDMHDAFRKAGIVRHYTKFPVVHGVGTSGP
FT                   RRGDHVWPEENFVLTTYCEEEELDAIVDVVRELKDFFCDEGIKVFVSKAKEIL"
     MKLLRVEIIA NRSIEEDMHD AFRKAGIVRH YTKFPVVHGV GTSGPRRGDH VWPEENFVLT        60
     TYCEEEELDA IVDVVRELKD FFCDEGIKVF VSKAKEIL                                98
//

If you have problems or comments...

PBIL Back to PBIL home page