(data stored in ACNUC7421 zone)

EMBL: CP002116.PE390

CP002116.PE390       Location/Qualifiers
FT   CDS             411620..411874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0395"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gfo:GFO_0860 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79550"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB20"
FT                   /protein_id="ADK79550.1"
FT                   /translation="MNKKLTLSVDDSIIEKAKAYAEDKNESLSQLVENYFRLLTADRRA
FT                   KEKEISPLVNDLMGTITVPEDFDYKTAKLEYLESRYLND"
     MNKKLTLSVD DSIIEKAKAY AEDKNESLSQ LVENYFRLLT ADRRAKEKEI SPLVNDLMGT        60
     ITVPEDFDYK TAKLEYLESR YLND                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page