(data stored in ACNUC7421 zone)

EMBL: CP002116.PE4

CP002116.PE4         Location/Qualifiers
FT   CDS             2880..3956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="COGs: COG1195 Recombinational DNA repair ATPase
FT                   (RecF pathway); InterPro IPR001238:IPR003395:IPR018078;
FT                   KEGG: tde:TDE0230 DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; SPTR: DNA replication and repair
FT                   protein recF; TIGRFAM: DNA replication and repair protein
FT                   RecF; PFAM: RecF/RecN/SMC N terminal domain; TIGRFAM: recF
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79164"
FT                   /db_xref="GOA:E1R6N2"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6N2"
FT                   /protein_id="ADK79164.1"
FT                   /translation="MGFLALKTYQYRNLKDAEVCLDAPRVFLVGENGQGKSNLLEAIYL
FT                   LSFGSSFRTRRDQELIRRGCGELALHGKTAEHDISFLLSGKNGTTKSIKLDGKPVTDRK
FT                   ELVRIFPAIVFCHDDISFVNGSPERRRWFFDQTMSLHEPLFIDTLRSYRKILKLRNMAL
FT                   KEDRRDLLDVYDIQLARAGMEIQEKRREAIEGFNTTFSSLHEKVSGLEGEMKIAYRPSW
FT                   KGCKGEEDVGVLLHRRRESDLEMKTSGSGPHRDRFAFLLEGRDFSSIASTGQLRLLSLL
FT                   LRVGQARFFYEKCGRRPVLLLDDVLLELDPRRRQRFLGTLPEADQIFFTFLPDRQYSEL
FT                   KGNDTMLLRVKEGEFIEE"
     MGFLALKTYQ YRNLKDAEVC LDAPRVFLVG ENGQGKSNLL EAIYLLSFGS SFRTRRDQEL        60
     IRRGCGELAL HGKTAEHDIS FLLSGKNGTT KSIKLDGKPV TDRKELVRIF PAIVFCHDDI       120
     SFVNGSPERR RWFFDQTMSL HEPLFIDTLR SYRKILKLRN MALKEDRRDL LDVYDIQLAR       180
     AGMEIQEKRR EAIEGFNTTF SSLHEKVSGL EGEMKIAYRP SWKGCKGEED VGVLLHRRRE       240
     SDLEMKTSGS GPHRDRFAFL LEGRDFSSIA STGQLRLLSL LLRVGQARFF YEKCGRRPVL       300
     LLDDVLLELD PRRRQRFLGT LPEADQIFFT FLPDRQYSEL KGNDTMLLRV KEGEFIEE         358
//

If you have problems or comments...

PBIL Back to PBIL home page