(data stored in ACNUC7421 zone)

EMBL: CP002116.PE40

CP002116.PE40        Location/Qualifiers
FT   CDS             40681..41802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0040"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="COGs: COG3437 Response regulator containing a
FT                   CheY-like receiver domain and an HD-GYP domain; InterPro
FT                   IPR003018:IPR003607:IPR006674; KEGG: wsu:WS1630 response
FT                   regulator; PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; GAF domain protein; SMART: GAF domain protein;
FT                   metal-dependent phosphohydrolase HD region; SPTR: Metal
FT                   dependent phosphohydrolase; PFAM: HD domain; GAF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79200"
FT                   /db_xref="GOA:E1R6R8"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6R8"
FT                   /protein_id="ADK79200.1"
FT                   /translation="MKNTELRKEPSAQELLKIIFKYINLIANERDVGRLLVALADMGRD
FT                   LITADRCTVWLVNQQRGELWSKIAHGVDRIVIPLSKGVAGYVATTGKSMITNDAYADER
FT                   FDKQVDSETGYRTRNIIALPIRDSAGEVMGVYQAINKMSGEDGFTERDLEHLQLAASYT
FT                   GSELEAVALQEEIEQTQREMIVTLAEAGEMRSKETGGHVRRVAEYSYLIALAMGMDAEE
FT                   AELLKNASPMHDIGKIAIPDAILLKEGPLTDEEREVMKTHTTIGYDMLKYSTRDLLKTS
FT                   AIVAYQHHEKWDGSGYPQGLVGEDIHIYARITAIADVFDALSCDRVYKAAWPKEKIVAL
FT                   FKAERGHHFDPVLCDIMDGLWDQLYAIKRQYSH"
     MKNTELRKEP SAQELLKIIF KYINLIANER DVGRLLVALA DMGRDLITAD RCTVWLVNQQ        60
     RGELWSKIAH GVDRIVIPLS KGVAGYVATT GKSMITNDAY ADERFDKQVD SETGYRTRNI       120
     IALPIRDSAG EVMGVYQAIN KMSGEDGFTE RDLEHLQLAA SYTGSELEAV ALQEEIEQTQ       180
     REMIVTLAEA GEMRSKETGG HVRRVAEYSY LIALAMGMDA EEAELLKNAS PMHDIGKIAI       240
     PDAILLKEGP LTDEEREVMK THTTIGYDML KYSTRDLLKT SAIVAYQHHE KWDGSGYPQG       300
     LVGEDIHIYA RITAIADVFD ALSCDRVYKA AWPKEKIVAL FKAERGHHFD PVLCDIMDGL       360
     WDQLYAIKRQ YSH                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page