(data stored in ACNUC7421 zone)

EMBL: CP002116.PE406

CP002116.PE406       Location/Qualifiers
FT   CDS             427961..428539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0414"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="COGs: COG1670 Acetyltransferase including
FT                   N-acetylase of ribosomal protein; InterPro IPR000182; KEGG:
FT                   str:Sterm_2425 GCN5-related N-acetyltransferase; PFAM:
FT                   GCN5-related N-acetyltransferase; SPTR: GCN5-related
FT                   N-acetyltransferase; PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79566"
FT                   /db_xref="GOA:E1RB36"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB36"
FT                   /protein_id="ADK79566.1"
FT                   /translation="MANMSLIGEKVYLNPTHENDIPFLANFMNDDHIKYFGRNCGSAIY
FT                   ETKMKTHFEENKEDERYTIFRKDNNEIIGDISINSIDIYNRAGSLSVIIYGKENRGKGF
FT                   GKEAILLILKHAFIDLNLENIDLGTWEYNKAAIHVYEKIGFKLIGRRRNRRIVGNSFYD
FT                   EIIMDMISDEYFKLYGNTELEKYKTKTEL"
     MANMSLIGEK VYLNPTHEND IPFLANFMND DHIKYFGRNC GSAIYETKMK THFEENKEDE        60
     RYTIFRKDNN EIIGDISINS IDIYNRAGSL SVIIYGKENR GKGFGKEAIL LILKHAFIDL       120
     NLENIDLGTW EYNKAAIHVY EKIGFKLIGR RRNRRIVGNS FYDEIIMDMI SDEYFKLYGN       180
     TELEKYKTKT EL                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page