(data stored in ACNUC7421 zone)

EMBL: CP002116.PE409

CP002116.PE409       Location/Qualifiers
FT   CDS             432219..433304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0418"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="COGs: COG3177 conserved hypothetical protein;
FT                   InterPro IPR003812; KEGG: gur:Gura_4148 filamentation
FT                   induced by cAMP protein Fic; PFAM: filamentation induced by
FT                   cAMP protein Fic; SPTR: Filamentation induced by cAMP
FT                   protein Fic; PFAM: Fic/DOC family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79569"
FT                   /db_xref="GOA:E1RB39"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR025758"
FT                   /db_xref="InterPro:IPR026287"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB39"
FT                   /protein_id="ADK79569.1"
FT                   /translation="MNSSEKRPNNELPLLPPNADIETKKILNQAIRANRELAILKGYCS
FT                   LLPNDSILLSAIILKEAKTSSEIENIVTTQDELYRALATTVKEIDVETKEVLNYRSAIW
FT                   RGFRQLKEKGFLSTNILIELQSELEGNSAGIRKLPGTALVNERTGKAIYIPPDNEEKIL
FT                   ELLKNLEKYINERDEIDPLIKMAVIHYQFESIHPFYDGNGRTGRIVNVLYLILQGLLDK
FT                   PILYLSEYIIKNKSEYYELLQKVRDEKGWEEWIVYMLKAVEITSIETLKLVSSIVELLN
FT                   KTTEVCREKLPKTTYSKELIELLFEQPYTKIEFLVNAGLAERRTASKYLKQLEEIGILE
FT                   SFKSWKERIYVNKRLYEVLKG"
     MNSSEKRPNN ELPLLPPNAD IETKKILNQA IRANRELAIL KGYCSLLPND SILLSAIILK        60
     EAKTSSEIEN IVTTQDELYR ALATTVKEID VETKEVLNYR SAIWRGFRQL KEKGFLSTNI       120
     LIELQSELEG NSAGIRKLPG TALVNERTGK AIYIPPDNEE KILELLKNLE KYINERDEID       180
     PLIKMAVIHY QFESIHPFYD GNGRTGRIVN VLYLILQGLL DKPILYLSEY IIKNKSEYYE       240
     LLQKVRDEKG WEEWIVYMLK AVEITSIETL KLVSSIVELL NKTTEVCREK LPKTTYSKEL       300
     IELLFEQPYT KIEFLVNAGL AERRTASKYL KQLEEIGILE SFKSWKERIY VNKRLYEVLK       360
     G                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page