(data stored in ACNUC7421 zone)

EMBL: CP002116.PE41

CP002116.PE41        Location/Qualifiers
FT   CDS             complement(41819..42910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0041"
FT                   /product="Patatin"
FT                   /note="COGs: COG3621 Patatin; InterPro IPR002641; KEGG:
FT                   cyc:PCC7424_4648 patatin; PFAM: Patatin; SPTR: Patatin
FT                   family protein; PFAM: Patatin-like phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79201"
FT                   /db_xref="GOA:E1R6R9"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6R9"
FT                   /protein_id="ADK79201.1"
FT                   /translation="MNHINSLWYSRLVPGRTIRILSVDGGGIRGYLAALILEEIEKKRT
FT                   EIGRKKPFCRCFDMMAGTSTGSLISLGLAVPQSRKLPTDSPEESSKKTPLMPRLINILS
FT                   TNAHPKYNAAEIARLYREKGTEIFPRYIFKQLNTVRQAFVEKYDAGNFDRVLEDIFGDL
FT                   TLRDALGRVLITSYDTLSARPIIMKNLPGEENFYMKDAARGSSAAPSYFSPVEVTGLDS
FT                   NAPFCLVDGGVFANNPAMCAYVEARRLFPLARKFFILSLGSGQLEQRLSYKQVKSWGYV
FT                   EWVLPQNNVPLFGMMSTGQNKCVDYQLNHLPGVTYIRFNPLLNGCSEEMDDAGAKNMEC
FT                   LEAVAKRTIEGNRRLIDLIARFL"
     MNHINSLWYS RLVPGRTIRI LSVDGGGIRG YLAALILEEI EKKRTEIGRK KPFCRCFDMM        60
     AGTSTGSLIS LGLAVPQSRK LPTDSPEESS KKTPLMPRLI NILSTNAHPK YNAAEIARLY       120
     REKGTEIFPR YIFKQLNTVR QAFVEKYDAG NFDRVLEDIF GDLTLRDALG RVLITSYDTL       180
     SARPIIMKNL PGEENFYMKD AARGSSAAPS YFSPVEVTGL DSNAPFCLVD GGVFANNPAM       240
     CAYVEARRLF PLARKFFILS LGSGQLEQRL SYKQVKSWGY VEWVLPQNNV PLFGMMSTGQ       300
     NKCVDYQLNH LPGVTYIRFN PLLNGCSEEM DDAGAKNMEC LEAVAKRTIE GNRRLIDLIA       360
     RFL                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page