(data stored in ACNUC7421 zone)

EMBL: CP002116.PE410

CP002116.PE410       Location/Qualifiers
FT   CDS             433565..434089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0419"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: abn:AB57_2683 hypothetical protein; SPTR:
FT                   Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79570"
FT                   /db_xref="InterPro:IPR027823"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB40"
FT                   /protein_id="ADK79570.1"
FT                   /translation="MKRSISLFFIVPIIVSCVQIPYDPDIDYPDKYEVILELSNMPKNE
FT                   IFLKANKWFISNFSSENSIILISDKEYGYIIGTIFDSFVDVNTFYQMKFDVNIEIKGNR
FT                   VRMTFENPHEKYTGTIYGTISTMMGETDDGNDYKPDFRRMTSNKHLAETNRRWRKNAES
FT                   FNLFMATEDDW"
     MKRSISLFFI VPIIVSCVQI PYDPDIDYPD KYEVILELSN MPKNEIFLKA NKWFISNFSS        60
     ENSIILISDK EYGYIIGTIF DSFVDVNTFY QMKFDVNIEI KGNRVRMTFE NPHEKYTGTI       120
     YGTISTMMGE TDDGNDYKPD FRRMTSNKHL AETNRRWRKN AESFNLFMAT EDDW             174
//

If you have problems or comments...

PBIL Back to PBIL home page