(data stored in ACNUC7421 zone)

EMBL: CP002116.PE417

CP002116.PE417       Location/Qualifiers
FT   CDS             440891..441829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0428"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="COGs: COG0111 Phosphoglycerate dehydrogenase and
FT                   related dehydrogenase; InterPro IPR006139:IPR006140; KEGG:
FT                   dtu:Dtur_1775 D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; PFAM: D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase catalytic region; SPTR: D-isomer specific
FT                   2-hydroxyacid dehydrogenase NAD-binding; PFAM: D-isomer
FT                   specific 2-hydroxyacid dehydrogenase, NAD binding domain;
FT                   D-isomer specific 2-hydroxyacid dehydrogenase, catalytic
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79577"
FT                   /db_xref="GOA:E1RB47"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB47"
FT                   /protein_id="ADK79577.1"
FT                   /translation="MHNIAIITTAFGNGLPDREHTYAALADELELRIRYCTKEELLADP
FT                   KGIKGVIVGVEKADKELFTCPDLRVAMKFGVGLDNFDMESAGKAHVQVVNMPGINSDAV
FT                   AEMTITLMLCVSRMILPMGQRMSNGQFVQYCSHTVQHKKLGIIGMGTIGRKVAKMATAL
FT                   GMECLGYDVRTFDLEGVNMVDLPTLFEQSDVITIHIPLMSTTHHLIGKEAFSRMKHGVI
FT                   LINTSRGGVVDDEELYERLQNGHIMGAGLDVFENEEIRNRLVTHENVICTPHVAAYTHE
FT                   TLRFMENTALKKIKACLAGEKNHEVSKGGTV"
     MHNIAIITTA FGNGLPDREH TYAALADELE LRIRYCTKEE LLADPKGIKG VIVGVEKADK        60
     ELFTCPDLRV AMKFGVGLDN FDMESAGKAH VQVVNMPGIN SDAVAEMTIT LMLCVSRMIL       120
     PMGQRMSNGQ FVQYCSHTVQ HKKLGIIGMG TIGRKVAKMA TALGMECLGY DVRTFDLEGV       180
     NMVDLPTLFE QSDVITIHIP LMSTTHHLIG KEAFSRMKHG VILINTSRGG VVDDEELYER       240
     LQNGHIMGAG LDVFENEEIR NRLVTHENVI CTPHVAAYTH ETLRFMENTA LKKIKACLAG       300
     EKNHEVSKGG TV                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page