(data stored in ACNUC7421 zone)

EMBL: CP002116.PE42

CP002116.PE42        Location/Qualifiers
FT   CDS             complement(42907..44283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0042"
FT                   /product="MATE efflux family protein"
FT                   /note="COGs: COG0534 Na+-driven multidrug efflux pump;
FT                   InterPro IPR002528; KEGG: amt:Amet_4230 MATE efflux family
FT                   protein; PFAM: multi antimicrobial extrusion protein MatE;
FT                   SPTR: MATE efflux family protein; TIGRFAM: MATE efflux
FT                   family protein; PFAM: MatE; TIGRFAM: putative efflux
FT                   protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79202"
FT                   /db_xref="GOA:E1R6S0"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6S0"
FT                   /protein_id="ADK79202.1"
FT                   /translation="MHVTDQLFGDRSFRKELLRIAVPVALQNLLISSLSVVDTLMIGQL
FT                   GEVEIAAVGLANQLFFLSLLFFFGVSSGASVFIAQFWGKKDIPSIHRTVGFAFSFAGSA
FT                   AILFSLLSLTIPDQILRIFTTDEAVVTVGVEYLRVVGISYLFVAASVLSSVSLRSIEEA
FT                   ATPLRATTASIIANIILNYLLIFGKFGFPQMGVAGAALATTISRCLELIILYHAIFVKK
FT                   NILAAPVRTFFDFNSSFVRRFLKTATPVILNEMAWATGMVVYKIVFARMGTGVIAAMNI
FT                   VDTASNLLFIIFMGTSNACAVMIGKRVGMGKKEEAFTAGRHFIAIGFFFGAVVGLGALL
FT                   LARFIPGLFNVSDQVKLMTARVLRLFPIIFPLKALNIHTVIGIFRAGGDTAFSFFVDLS
FT                   GVWLVGVPLAFLGAFVWELPIHLLFLLLGMEEVCKTIMGLLRFRSRLWVRDITEGEVST
FT                   "
     MHVTDQLFGD RSFRKELLRI AVPVALQNLL ISSLSVVDTL MIGQLGEVEI AAVGLANQLF        60
     FLSLLFFFGV SSGASVFIAQ FWGKKDIPSI HRTVGFAFSF AGSAAILFSL LSLTIPDQIL       120
     RIFTTDEAVV TVGVEYLRVV GISYLFVAAS VLSSVSLRSI EEAATPLRAT TASIIANIIL       180
     NYLLIFGKFG FPQMGVAGAA LATTISRCLE LIILYHAIFV KKNILAAPVR TFFDFNSSFV       240
     RRFLKTATPV ILNEMAWATG MVVYKIVFAR MGTGVIAAMN IVDTASNLLF IIFMGTSNAC       300
     AVMIGKRVGM GKKEEAFTAG RHFIAIGFFF GAVVGLGALL LARFIPGLFN VSDQVKLMTA       360
     RVLRLFPIIF PLKALNIHTV IGIFRAGGDT AFSFFVDLSG VWLVGVPLAF LGAFVWELPI       420
     HLLFLLLGME EVCKTIMGLL RFRSRLWVRD ITEGEVST                               458
//

If you have problems or comments...

PBIL Back to PBIL home page