(data stored in ACNUC7421 zone)

EMBL: CP002116.PE420

CP002116.PE420       Location/Qualifiers
FT   CDS             443388..444878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0431"
FT                   /product="protein of unknown function DUF112 transmembrane"
FT                   /note="COGs: COG3333 conserved hypothetical protein;
FT                   InterPro IPR002823; KEGG: tle:Tlet_1876 hypothetical
FT                   protein; PFAM: protein of unknown function DUF112
FT                   transmembrane; SPTR: Putative uncharacterized protein;
FT                   PFAM: Tripartite tricarboxylate transporter TctA family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79580"
FT                   /db_xref="GOA:E1RB50"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB50"
FT                   /protein_id="ADK79580.1"
FT                   /translation="MTEVLNLALLMQPKTLMFAILATFLGIVVGALPGLTATMAVSILV
FT                   SLTFGLNTAEAIVILISVFLGGIYGGSRSAILLNVPGTPSSAATALDGWPLSKRGEGGD
FT                   VGILVTTFSSLAGIFGLIVLALLTPVIAKFALKFGYWEYFWLAIMGVLISATLTTGDMK
FT                   NYKGIITGFAGMLIACVGLDPIHGLPRLCFGTTQLYGGINLVPAMIGLFGLTEAFSALM
FT                   EPSSHDILDGGPEAKLGSLVKKSFSLLKRYPINFARSSIIGTFIGALPGVGPDIASWVA
FT                   YGTAKKQSKTPEEYGHGSYEGIIASETANNAATSGVFIPLLTLGIPGDAVSAIILGGIQ
FT                   MHGYKPGPTFFFENPGFVYFLAGTLFIVNVIMWIEGCAITKVISKILKAPVGILMPIVM
FT                   VFCVFGAYMINLRKFDVILMLCFGLLGIVMRKFKLPPAPMALGIILGTLADTNFRQAML
FT                   AGRYSAAPFFTRPLSLIMFLVILTALLSPLFKRFGKTK"
     MTEVLNLALL MQPKTLMFAI LATFLGIVVG ALPGLTATMA VSILVSLTFG LNTAEAIVIL        60
     ISVFLGGIYG GSRSAILLNV PGTPSSAATA LDGWPLSKRG EGGDVGILVT TFSSLAGIFG       120
     LIVLALLTPV IAKFALKFGY WEYFWLAIMG VLISATLTTG DMKNYKGIIT GFAGMLIACV       180
     GLDPIHGLPR LCFGTTQLYG GINLVPAMIG LFGLTEAFSA LMEPSSHDIL DGGPEAKLGS       240
     LVKKSFSLLK RYPINFARSS IIGTFIGALP GVGPDIASWV AYGTAKKQSK TPEEYGHGSY       300
     EGIIASETAN NAATSGVFIP LLTLGIPGDA VSAIILGGIQ MHGYKPGPTF FFENPGFVYF       360
     LAGTLFIVNV IMWIEGCAIT KVISKILKAP VGILMPIVMV FCVFGAYMIN LRKFDVILML       420
     CFGLLGIVMR KFKLPPAPMA LGIILGTLAD TNFRQAMLAG RYSAAPFFTR PLSLIMFLVI       480
     LTALLSPLFK RFGKTK                                                       496
//

If you have problems or comments...

PBIL Back to PBIL home page