(data stored in ACNUC7421 zone)

EMBL: CP002116.PE427

CP002116.PE427       Location/Qualifiers
FT   CDS             453745..454077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0440"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="InterPro IPR002514; KEGG: pvi:Cvib_1307 transposase
FT                   IS3/IS911 family protein; PFAM: transposase IS3/IS911
FT                   family protein; SPTR: Transposase IS3/IS911 family protein;
FT                   PFAM: Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79587"
FT                   /db_xref="GOA:E1RB57"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB57"
FT                   /protein_id="ADK79587.1"
FT                   /translation="MYDTIYKEKYVRRKFDEEFKAEVALEALKEEKTLQELAEEYEVHP
FT                   NQISAWKKQLLQNASSLFERKNKKNQELDEVKKREQELYKQLGQAKYENEWLKKKYKQL
FT                   YGKDYE"
     MYDTIYKEKY VRRKFDEEFK AEVALEALKE EKTLQELAEE YEVHPNQISA WKKQLLQNAS        60
     SLFERKNKKN QELDEVKKRE QELYKQLGQA KYENEWLKKK YKQLYGKDYE                  110
//

If you have problems or comments...

PBIL Back to PBIL home page