(data stored in ACNUC7421 zone)

EMBL: CP002116.PE43

CP002116.PE43        Location/Qualifiers
FT   CDS             44427..45500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0043"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="COGs: COG1609 Transcriptional regulators; InterPro
FT                   IPR000843; KEGG: bcl:ABC3473 hypothetical protein; SMART:
FT                   regulatory protein LacI; SPTR: Putative uncharacterized
FT                   protein; PFAM: Bacterial regulatory proteins, lacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79203"
FT                   /db_xref="GOA:E1R6S1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6S1"
FT                   /protein_id="ADK79203.1"
FT                   /translation="MKKIVTQKDIAQALHIGQMTVYRALHNKGNISPELRERILAYADE
FT                   VGYQANRAAQTLVQKKVTRIVLFSTDTPRFFWDSVESGIGLAKEQVKHFNYSVEYYRIA
FT                   NKNSVEYLSALTAVIAEGVDAVGLVNNEEYDMTAIFRVLDDAQVPYILFNIDAKESHRL
FT                   CYIGPDYIGGGRLAAEFLGKCVAGTSKILVITDDHTKQNISAEVNHLRIDGFMSVMKER
FT                   YPSIINTIQGVDLEQGATDVGLELKTIINESEVCFDAIYLVPPINQLLMEVLAESKRPL
FT                   PKVLLHDTFPGYKEFFARDMITAIIFQNPIQQGFYAVKVLEEMVETGFIPRDDIHLVQE
FT                   VMLAENSDLDKNHLSFD"
     MKKIVTQKDI AQALHIGQMT VYRALHNKGN ISPELRERIL AYADEVGYQA NRAAQTLVQK        60
     KVTRIVLFST DTPRFFWDSV ESGIGLAKEQ VKHFNYSVEY YRIANKNSVE YLSALTAVIA       120
     EGVDAVGLVN NEEYDMTAIF RVLDDAQVPY ILFNIDAKES HRLCYIGPDY IGGGRLAAEF       180
     LGKCVAGTSK ILVITDDHTK QNISAEVNHL RIDGFMSVMK ERYPSIINTI QGVDLEQGAT       240
     DVGLELKTII NESEVCFDAI YLVPPINQLL MEVLAESKRP LPKVLLHDTF PGYKEFFARD       300
     MITAIIFQNP IQQGFYAVKV LEEMVETGFI PRDDIHLVQE VMLAENSDLD KNHLSFD          357
//

If you have problems or comments...

PBIL Back to PBIL home page