(data stored in ACNUC7421 zone)

EMBL: CP002116.PE436

CP002116.PE436       Location/Qualifiers
FT   CDS             complement(461155..461373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79596"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB66"
FT                   /protein_id="ADK79596.1"
FT                   /translation="MVTWEAMTPEERDRFIYLILSEDALKTIVLIMQKKYGPTVSTETI
FT                   MRFAFKVAVNRMTPQHLKHVSPRERHT"
     MVTWEAMTPE ERDRFIYLIL SEDALKTIVL IMQKKYGPTV STETIMRFAF KVAVNRMTPQ        60
     HLKHVSPRER HT                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page