(data stored in ACNUC7421 zone)

EMBL: CP002116.PE44

CP002116.PE44        Location/Qualifiers
FT   CDS             45662..46897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0044"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="COGs: COG1653 ABC-type sugar transport system
FT                   periplasmic component; InterPro IPR006059; KEGG:
FT                   extracellular solute-binding protein; PFAM: extracellular
FT                   solute-binding protein family 1; SPTR: Extracellular
FT                   solute-binding protein family 1; PFAM: Bacterial
FT                   extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79204"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6S2"
FT                   /protein_id="ADK79204.1"
FT                   /translation="MKKIGVMIVLLIFLSTFTYASGDQEAGKTELFFFCGHGDLEEGTK
FT                   EIIAAYEETHPNIKITTIFNSKDYATQFQSMMATDTLPDIVMVDQERLKEFVAADMLLD
FT                   LSDRPVASRLFDVAKEPNMIDGRLYSVPFHLQGYGMLYNPKLLAQAHINKVPSTLSELK
FT                   AAVDKLNAAGITPFTSMFNETWAADQYLLFGISPILNQDPSLVAGLYNGTVKFSDAKFS
FT                   EVFNYIDILKDNVPENPFSYSFGEGASYFGQGKAALAIHGDWILRTALAVDPNLDVHLA
FT                   ALPYSNVKENNKIVVGVANGLGIIKNSKHLQEAIDFFDYYSTLESAQILSKYNFSYVPQ
FT                   KGFDTKGLHAVYTDISEALDQGNVIPWEWLKVAPGGVKLEAGQSMQAYLSNQISQDQVM
FT                   ENVQAAFDDAVK"
     MKKIGVMIVL LIFLSTFTYA SGDQEAGKTE LFFFCGHGDL EEGTKEIIAA YEETHPNIKI        60
     TTIFNSKDYA TQFQSMMATD TLPDIVMVDQ ERLKEFVAAD MLLDLSDRPV ASRLFDVAKE       120
     PNMIDGRLYS VPFHLQGYGM LYNPKLLAQA HINKVPSTLS ELKAAVDKLN AAGITPFTSM       180
     FNETWAADQY LLFGISPILN QDPSLVAGLY NGTVKFSDAK FSEVFNYIDI LKDNVPENPF       240
     SYSFGEGASY FGQGKAALAI HGDWILRTAL AVDPNLDVHL AALPYSNVKE NNKIVVGVAN       300
     GLGIIKNSKH LQEAIDFFDY YSTLESAQIL SKYNFSYVPQ KGFDTKGLHA VYTDISEALD       360
     QGNVIPWEWL KVAPGGVKLE AGQSMQAYLS NQISQDQVME NVQAAFDDAV K                411
//

If you have problems or comments...

PBIL Back to PBIL home page