(data stored in ACNUC7421 zone)

EMBL: CP002116.PE444

CP002116.PE444       Location/Qualifiers
FT   CDS             468316..469230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0457"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bdu:BDU_173 hypothetical protein; SPTR:
FT                   Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79604"
FT                   /db_xref="GOA:E1RB74"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB74"
FT                   /protein_id="ADK79604.1"
FT                   /translation="MKRLLLVLFLAPMLLPAQEITEQPLIVSRQLFLPAEYYVGDSVEL
FT                   RLTLEGVDPDSLEIPSTLPDVPWIEIRDISIERDSVGSELTIHFTTYMPGTRTLPSIVF
FT                   GEGKVLEGVKIHASSILDDTNAPFSPARGQLLLPGTSVGLILFGLLIFLGPVLTLLLAG
FT                   KGRRFFRGIMERHRGRRPARIFYRRLRELEDNFDKIAGRDFYFTMTGILRSYLTQRTGE
FT                   DFLSATSREFGFLCDRFFDDQALVAALAEMDHISDGVKFGGERVHTDRKRHDLALLKDV
FT                   ASYVERRAEGHRSSNRRKGRGSV"
     MKRLLLVLFL APMLLPAQEI TEQPLIVSRQ LFLPAEYYVG DSVELRLTLE GVDPDSLEIP        60
     STLPDVPWIE IRDISIERDS VGSELTIHFT TYMPGTRTLP SIVFGEGKVL EGVKIHASSI       120
     LDDTNAPFSP ARGQLLLPGT SVGLILFGLL IFLGPVLTLL LAGKGRRFFR GIMERHRGRR       180
     PARIFYRRLR ELEDNFDKIA GRDFYFTMTG ILRSYLTQRT GEDFLSATSR EFGFLCDRFF       240
     DDQALVAALA EMDHISDGVK FGGERVHTDR KRHDLALLKD VASYVERRAE GHRSSNRRKG       300
     RGSV                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page