(data stored in ACNUC7421 zone)

EMBL: CP002116.PE445

CP002116.PE445       Location/Qualifiers
FT   CDS             469227..470228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0458"
FT                   /product="von Willebrand factor type A"
FT                   /note="InterPro IPR002035; KEGG: bhr:BH0173 hypothetical
FT                   membrane spanning protein; PFAM: von Willebrand factor type
FT                   A; SMART: von Willebrand factor type A; SPTR: Hypothetical
FT                   membrane spanning protein; PFAM: von Willebrand factor type
FT                   A domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79605"
FT                   /db_xref="GOA:E1RB75"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB75"
FT                   /protein_id="ADK79605.1"
FT                   /translation="MITFDQPGILLFLAVLPPAMFLTYGWKRRGGLLPLSFTMWERDRF
FT                   ESPLFFHRFLLFLANVSLWLGVASLIVALAGPRLVEREKIYLHRGVDIVFVLDQSPSMI
FT                   VRDFGGDTRFDAAKHAIRTFVEGREHDPLGLVIFGDEAALVTPPTLDYTSFLSRMDAVR
FT                   VMKLGRGSALGLGMAVATVHLEKSSAERKVMVIVSDGENNAGEITPESAARVAASLGIR
FT                   IYAVGVGGEGSVATEFTDPETGKSYRGTYEGKIDMELLKAVTESTRGQAFLAGSPGALS
FT                   QVFREIDALESVELRSTTDISSEPVHHLLIRLGLWLLVFYAFVKRLFFREVL"
     MITFDQPGIL LFLAVLPPAM FLTYGWKRRG GLLPLSFTMW ERDRFESPLF FHRFLLFLAN        60
     VSLWLGVASL IVALAGPRLV EREKIYLHRG VDIVFVLDQS PSMIVRDFGG DTRFDAAKHA       120
     IRTFVEGREH DPLGLVIFGD EAALVTPPTL DYTSFLSRMD AVRVMKLGRG SALGLGMAVA       180
     TVHLEKSSAE RKVMVIVSDG ENNAGEITPE SAARVAASLG IRIYAVGVGG EGSVATEFTD       240
     PETGKSYRGT YEGKIDMELL KAVTESTRGQ AFLAGSPGAL SQVFREIDAL ESVELRSTTD       300
     ISSEPVHHLL IRLGLWLLVF YAFVKRLFFR EVL                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page