(data stored in ACNUC7421 zone)

EMBL: CP002116.PE45

CP002116.PE45        Location/Qualifiers
FT   CDS             46998..47873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0045"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1175 ABC-type sugar transport systems
FT                   permease components; InterPro IPR000515; KEGG:
FT                   pjd:Pjdr2_0386 binding-protein-dependent transport systems
FT                   inner membrane component; PFAM: binding-protein-dependent
FT                   transport systems inner membrane component; SPTR:
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component; PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79205"
FT                   /db_xref="GOA:E1R6S3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6S3"
FT                   /protein_id="ADK79205.1"
FT                   /translation="MKKHDYSADYFLFILPAFSLFFLFFLIPVFNGVRYSFFEWNGISA
FT                   TKTFVGLENFRNILNDKIFFEAFKNTLKFTVVHVLTVNLLALFLAVLLTKPSVVGRNFF
FT                   RGIFFLPNVLSLIVVGQIWKFFLGQASFELGKKIGVAVFQIGWLSDPQVALYSTIIASV
FT                   WQATGWYMLIYIAGITAIPRELYEAATIDGGRQVFVFRHITLPLLIPSLTICIFLSTIN
FT                   SLRVFDIVYAMTGGGPGHATETALLNIYNTTFNSFKYGYGTAKAIVLLIVIIVVSFTQI
FT                   ILLKRKEVDL"
     MKKHDYSADY FLFILPAFSL FFLFFLIPVF NGVRYSFFEW NGISATKTFV GLENFRNILN        60
     DKIFFEAFKN TLKFTVVHVL TVNLLALFLA VLLTKPSVVG RNFFRGIFFL PNVLSLIVVG       120
     QIWKFFLGQA SFELGKKIGV AVFQIGWLSD PQVALYSTII ASVWQATGWY MLIYIAGITA       180
     IPRELYEAAT IDGGRQVFVF RHITLPLLIP SLTICIFLST INSLRVFDIV YAMTGGGPGH       240
     ATETALLNIY NTTFNSFKYG YGTAKAIVLL IVIIVVSFTQ IILLKRKEVD L                291
//

If you have problems or comments...

PBIL Back to PBIL home page