(data stored in ACNUC7421 zone)

EMBL: CP002116.PE459

CP002116.PE459       Location/Qualifiers
FT   CDS             481076..482224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0472"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lbz:LbrM20_V2.2080 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79619"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB89"
FT                   /protein_id="ADK79619.1"
FT                   /translation="MSAMKNELSKAKHDLEALLVSLGEKSSLLGAGNLALKISDESGAD
FT                   ELRLRALSSREKLEKIEKEIRRIRSLLSEKEEVERRIEELVASEKELSERRTRLYGEIG
FT                   RKGFESYQKGALTDERFSSLFSEIVEYSDREKKALEELRDLEASKERSPLLKRITFGAK
FT                   ITLAKNNLTGLRKEQDKAYLKVGEALFGQELASAIVDPQLLTLIATFRESERREEELRG
FT                   ERSEAEKKRQDLVTQLADAGADKNSTKCLRDLDQKRVEAETAVAESDRDYGATLLLMPE
FT                   LRELIRKEGDASLLEEVAELEKKEEFLRTRIAALEAGIEAEEKREELEKQRTQLEKVKR
FT                   KREELDAEMKEIKKRISEGEKELNRLLEAADVDQSSESDVSE"
     MSAMKNELSK AKHDLEALLV SLGEKSSLLG AGNLALKISD ESGADELRLR ALSSREKLEK        60
     IEKEIRRIRS LLSEKEEVER RIEELVASEK ELSERRTRLY GEIGRKGFES YQKGALTDER       120
     FSSLFSEIVE YSDREKKALE ELRDLEASKE RSPLLKRITF GAKITLAKNN LTGLRKEQDK       180
     AYLKVGEALF GQELASAIVD PQLLTLIATF RESERREEEL RGERSEAEKK RQDLVTQLAD       240
     AGADKNSTKC LRDLDQKRVE AETAVAESDR DYGATLLLMP ELRELIRKEG DASLLEEVAE       300
     LEKKEEFLRT RIAALEAGIE AEEKREELEK QRTQLEKVKR KREELDAEMK EIKKRISEGE       360
     KELNRLLEAA DVDQSSESDV SE                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page