(data stored in ACNUC7421 zone)

EMBL: CP002116.PE46

CP002116.PE46        Location/Qualifiers
FT   CDS             47882..48712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0046"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG0395 ABC-type sugar transport system
FT                   permease component; InterPro IPR000515; KEGG: bmq:BMQ_2796
FT                   putative ABC transporter, permease protein; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Binding-protein-dependent transport
FT                   systems inner membrane component; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79206"
FT                   /db_xref="GOA:E1R6S4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6S4"
FT                   /protein_id="ADK79206.1"
FT                   /translation="MSVEKLLKTILIYIILIIGVSIFIAPFYFVIINSLKTNSEYLVSK
FT                   LVLPSSFYVDNYVATIEMMKYGKTLLNSIVITAFSVFGILVIASMAAYKIARTKGILNT
FT                   ILFFLFLSVFVVPFQSVMIPIVVMARRLSLMNKLYGMVLVYLGLVSPTAIFLYRGFIQT
FT                   IPLSLEECAQIDGASVYQIFFRIVLPLLKPITSTIIILLGLQIWNDFLLPLLMLQTPKN
FT                   YTLPLATMRFFQTYNTAWGNILAATVLSSIPMIILFFSAQKQIVQGVTSGAIKG"
     MSVEKLLKTI LIYIILIIGV SIFIAPFYFV IINSLKTNSE YLVSKLVLPS SFYVDNYVAT        60
     IEMMKYGKTL LNSIVITAFS VFGILVIASM AAYKIARTKG ILNTILFFLF LSVFVVPFQS       120
     VMIPIVVMAR RLSLMNKLYG MVLVYLGLVS PTAIFLYRGF IQTIPLSLEE CAQIDGASVY       180
     QIFFRIVLPL LKPITSTIII LLGLQIWNDF LLPLLMLQTP KNYTLPLATM RFFQTYNTAW       240
     GNILAATVLS SIPMIILFFS AQKQIVQGVT SGAIKG                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page