(data stored in ACNUC7421 zone)

EMBL: CP002116.PE460

CP002116.PE460       Location/Qualifiers
FT   CDS             482221..483474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0473"
FT                   /product="permease for cytosine/purines uracil thiamine
FT                   allantoin"
FT                   /note="COGs: COG1457 Purine-cytosine permease and related
FT                   protein; InterPro IPR001248; KEGG: tsi:TSIB_0467 probable
FT                   hydroxymethylpyrimidine transporter CytX; PFAM: permease
FT                   for cytosine/purines uracil thiamine allantoin; SPTR:
FT                   Probable hydroxymethylpyrimidine transporter CytX; PFAM:
FT                   Permease for cytosine/purines, uracil, thiamine, allantoin;
FT                   TIGRFAM: NCS1 nucleoside transporter family; probable
FT                   hydroxymethylpyrimidine transporter CytX"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79620"
FT                   /db_xref="GOA:E1RB90"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB90"
FT                   /protein_id="ADK79620.1"
FT                   /translation="MIDKGARTLSGFGTALLWAGVAVSVSEIWAGSLLQDAGLFAGLLI
FT                   IVIGHLFGGLVLSASGTMGTRYGIMSMQSTRMVLGNRGSIIPSLLNVFQLVGWATIMLA
FT                   LSGSIGASVGHRLGAPFNSKAFWILLIGAGTLAWSFLVGSSKLQWVHTVVIIGLVLISA
FT                   LMTWIALNPHYYTMKPAAADSFSFTRGMRLMDLVIVMPISWVPLISDYSRLAKSERGGF
FT                   WGSFLGYGIVSCWMYGIGLVISLATGTEDPAANILRLMGTLGLTIPAVVLVFASTMTSD
FT                   FPDIYSSACSLFNINSKIKPAWTMWGTGILTIILALFFDLSRFETFLNVVGAFFIPLFA
FT                   ILLTDYFLIRKQDLTGLDFAVGSGMNFSGGFRIKGLLVWGIGTLVYFLARAVDCPLGAS
FT                   ITAFLVSSVIYLLLEKRT"
     MIDKGARTLS GFGTALLWAG VAVSVSEIWA GSLLQDAGLF AGLLIIVIGH LFGGLVLSAS        60
     GTMGTRYGIM SMQSTRMVLG NRGSIIPSLL NVFQLVGWAT IMLALSGSIG ASVGHRLGAP       120
     FNSKAFWILL IGAGTLAWSF LVGSSKLQWV HTVVIIGLVL ISALMTWIAL NPHYYTMKPA       180
     AADSFSFTRG MRLMDLVIVM PISWVPLISD YSRLAKSERG GFWGSFLGYG IVSCWMYGIG       240
     LVISLATGTE DPAANILRLM GTLGLTIPAV VLVFASTMTS DFPDIYSSAC SLFNINSKIK       300
     PAWTMWGTGI LTIILALFFD LSRFETFLNV VGAFFIPLFA ILLTDYFLIR KQDLTGLDFA       360
     VGSGMNFSGG FRIKGLLVWG IGTLVYFLAR AVDCPLGASI TAFLVSSVIY LLLEKRT          417
//

If you have problems or comments...

PBIL Back to PBIL home page