(data stored in ACNUC7421 zone)

EMBL: CP002116.PE462

CP002116.PE462       Location/Qualifiers
FT   CDS             complement(485454..488576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0475"
FT                   /product="Respiratory-chain NADH dehydrogenase domain 51
FT                   kDa subunit"
FT                   /note="COGs: COG1894 NADH:ubiquinone oxidoreductase
FT                   NADH-binding (51 kD) subunit;
FT                   InterProIPR013027:IPR000103:IPR002023:IPR011538:IPR
FT                   019554:IPR019575:IPR019794:IPR001949; KEGG: dal:Dalk_2559
FT                   respiratory-chain NADH dehydrogenase domain 51 kDa subunit;
FT                   PFAM: Respiratory-chain NADH dehydrogenase domain 51 kDa
FT                   subunit; NADH dehydrogenase (ubiquinone) 24 kDa subunit;
FT                   Soluble ligand binding domain; NADH ubiquinone
FT                   oxidoreductase, F subunit, iron sulphur binding;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; SPTR: Putative uncharacterized protein;
FT                   PFAM: NADH-ubiquinone oxidoreductase-F iron-sulfur binding
FT                   region; Pyridine nucleotide-disulphide oxidoreductase;
FT                   Respiratory-chain NADH dehydrogenase 24 Kd subunit;
FT                   Respiratory-chain NADH dehydrogenase 51 Kd subunit; SLBB
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79622"
FT                   /db_xref="GOA:E1RB92"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB92"
FT                   /protein_id="ADK79622.1"
FT                   /translation="MKRIGNSNELTQVQKQLCASERKKRHLIRVCAGGGCLASGSIEVM
FT                   EALESNLKELAVDASVKKTGCLGPCARGPVVMIEPEGLFYEGVHPEDCREICETLYKAG
FT                   KNGTVDPIEHLLHYNRAEQRSVVKVDEVDFYRGQAKIVLSRCGVVDPDSIEDAIACGAY
FT                   TALAKVLNEEDADKVIDTLKISGLRGRGGAGFPTWLKWDFTRKSPGEEKYVLCNADEGD
FT                   PGAFMDRSVLEGDPHALIEGMAIAGKTIGADHGVVYVRAEYPLAVKRLGHAIEAAKESG
FT                   LLGENILGSEFNFDIEIRMGSGAFVCGEETALIASIEGKRGEPRPRPPFPANKGLWGKP
FT                   SLLNNVETYANIAGIIKKGAEWYASFGTTESKGTKVFALAGAISTSGLVEVPIGTCLGE
FT                   VVFDIGGGIPGGKEFKAAQIGGPSGGCIPREYLNVPLDYASLQELGAIMGSGGLIVMDD
FT                   DTCMVDVARYFLEFVQEESCGKCTPCRVGTKRMLEILERICNGKGEMEDIDRLIELGTK
FT                   IKETALCGLGQTAPNPVLSTIRHFRHEYEEHIRDHHCTAGVCSALVRAPCQSACPAGVD
FT                   IPGFISLVKERRYAEALRLHRERNPFAAVCARVCFHTCEDKCRRAGIDEAVAIRAIKRY
FT                   MVDQEVTVQRPEVREDADREVRKVAIIGAGPAGLSCSYFLARLGYRPRIFEAQSRPGGM
FT                   LVQTIPAYRLPRETLAREIRMIEQIGVDIVTDKRLGRDFSLQDLRDEGYEAIFIAVGAP
FT                   GNLRLGIKGEDAEGVVQGIDFLRTYNIRGSVSVGERIVVVGGGNAAVDAARTAIRLGAK
FT                   EVTMLYRRSREQMPAYAEEIEEALLEGVKLMSLTQPSEILTDEKGAVRAIRCHGMTLGE
FT                   FDRSGRRRPTDDEAQPFEIETDQIIIAIGQALDKKTFAGATEIPIGGNRFIAANQRDGS
FT                   TAIPWLFAGGDAATGPNSVVSAIASGEKAAVGIDTALFGSCDPFWRKEKKLDTDYDPTA
FT                   DPVPYPREKIPTIEIERRKNNFDEVEKTWTESVAIRQCARCLRCDYGKEQV"
     MKRIGNSNEL TQVQKQLCAS ERKKRHLIRV CAGGGCLASG SIEVMEALES NLKELAVDAS        60
     VKKTGCLGPC ARGPVVMIEP EGLFYEGVHP EDCREICETL YKAGKNGTVD PIEHLLHYNR       120
     AEQRSVVKVD EVDFYRGQAK IVLSRCGVVD PDSIEDAIAC GAYTALAKVL NEEDADKVID       180
     TLKISGLRGR GGAGFPTWLK WDFTRKSPGE EKYVLCNADE GDPGAFMDRS VLEGDPHALI       240
     EGMAIAGKTI GADHGVVYVR AEYPLAVKRL GHAIEAAKES GLLGENILGS EFNFDIEIRM       300
     GSGAFVCGEE TALIASIEGK RGEPRPRPPF PANKGLWGKP SLLNNVETYA NIAGIIKKGA       360
     EWYASFGTTE SKGTKVFALA GAISTSGLVE VPIGTCLGEV VFDIGGGIPG GKEFKAAQIG       420
     GPSGGCIPRE YLNVPLDYAS LQELGAIMGS GGLIVMDDDT CMVDVARYFL EFVQEESCGK       480
     CTPCRVGTKR MLEILERICN GKGEMEDIDR LIELGTKIKE TALCGLGQTA PNPVLSTIRH       540
     FRHEYEEHIR DHHCTAGVCS ALVRAPCQSA CPAGVDIPGF ISLVKERRYA EALRLHRERN       600
     PFAAVCARVC FHTCEDKCRR AGIDEAVAIR AIKRYMVDQE VTVQRPEVRE DADREVRKVA       660
     IIGAGPAGLS CSYFLARLGY RPRIFEAQSR PGGMLVQTIP AYRLPRETLA REIRMIEQIG       720
     VDIVTDKRLG RDFSLQDLRD EGYEAIFIAV GAPGNLRLGI KGEDAEGVVQ GIDFLRTYNI       780
     RGSVSVGERI VVVGGGNAAV DAARTAIRLG AKEVTMLYRR SREQMPAYAE EIEEALLEGV       840
     KLMSLTQPSE ILTDEKGAVR AIRCHGMTLG EFDRSGRRRP TDDEAQPFEI ETDQIIIAIG       900
     QALDKKTFAG ATEIPIGGNR FIAANQRDGS TAIPWLFAGG DAATGPNSVV SAIASGEKAA       960
     VGIDTALFGS CDPFWRKEKK LDTDYDPTAD PVPYPREKIP TIEIERRKNN FDEVEKTWTE      1020
     SVAIRQCARC LRCDYGKEQV                                                  1040
//

If you have problems or comments...

PBIL Back to PBIL home page