(data stored in ACNUC7421 zone)

EMBL: CP002116.PE468

CP002116.PE468       Location/Qualifiers
FT   CDS             495099..495815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0481"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="InterPro IPR007272; KEGG: tit:Thit_0076 protein of
FT                   unknown function DUF395 YeeE/YedE; PFAM: protein of unknown
FT                   function DUF395 YeeE/YedE; SPTR: Putative uncharacterized
FT                   protein; PFAM: YeeE/YedE family (DUF395)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79628"
FT                   /db_xref="GOA:E1RB98"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:E1RB98"
FT                   /protein_id="ADK79628.1"
FT                   /translation="MSDEKKPDQQSTGQSSIRRSTSSRSSGRSRKKKKNQLPIGIAVLA
FT                   VVVLIAILLGMKNELLAFFWITGIAFGYILQRARFCFTAAMRDPMLTGGTSLTRAVLIA
FT                   FAFTSIGFIAIKYGAFARGLPIPGQGYVVPVSFATVVGSFMFGIGMVIAGGCASGTLMR
FT                   VGEGFLMQVLSLFFFVIGSLWGAHDFGWWKLHVIMKGKAIFLPDLFGWIGAVIIQLLVI
FT                   VLLWIAADKWEKHKNA"
     MSDEKKPDQQ STGQSSIRRS TSSRSSGRSR KKKKNQLPIG IAVLAVVVLI AILLGMKNEL        60
     LAFFWITGIA FGYILQRARF CFTAAMRDPM LTGGTSLTRA VLIAFAFTSI GFIAIKYGAF       120
     ARGLPIPGQG YVVPVSFATV VGSFMFGIGM VIAGGCASGT LMRVGEGFLM QVLSLFFFVI       180
     GSLWGAHDFG WWKLHVIMKG KAIFLPDLFG WIGAVIIQLL VIVLLWIAAD KWEKHKNA         238
//

If you have problems or comments...

PBIL Back to PBIL home page