(data stored in ACNUC7421 zone)

EMBL: CP002116.PE472

CP002116.PE472       Location/Qualifiers
FT   CDS             complement(497963..498397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0485"
FT                   /product="heat shock protein Hsp20"
FT                   /note="COGs: COG0071 Molecular chaperone (small heat shock
FT                   protein); InterPro IPR002068; KEGG: tde:TDE1029 HSP20/alpha
FT                   crystallin family protein; PFAM: heat shock protein Hsp20;
FT                   SPTR: Small heat shock protein; PFAM: Hsp20/alpha
FT                   crystallin family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79632"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBA2"
FT                   /protein_id="ADK79632.1"
FT                   /translation="MRYMINYKPAFDFDTMLNSIFTPNDRWLQNGPAVNIIEEPDQYRL
FT                   EAELPGLSENEVEVKIDDRVLTIGSQRSEEDETNREKEENKAPNYLIRERRERSFSRSF
FT                   VLPKDVDSEKISGSFNNGILTIILEKLPEVKPRKIKVQAA"
     MRYMINYKPA FDFDTMLNSI FTPNDRWLQN GPAVNIIEEP DQYRLEAELP GLSENEVEVK        60
     IDDRVLTIGS QRSEEDETNR EKEENKAPNY LIRERRERSF SRSFVLPKDV DSEKISGSFN       120
     NGILTIILEK LPEVKPRKIK VQAA                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page