(data stored in ACNUC7421 zone)

EMBL: CP002116.PE478

CP002116.PE478       Location/Qualifiers
FT   CDS             504980..505705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0491"
FT                   /product="metallophosphoesterase"
FT                   /note="COGs: COG0622 phosphoesterase; InterPro
FT                   IPR004843:IPR011152; KEGG: tro:trd_1481 phosphatase family
FT                   protein; PFAM: metallophosphoesterase; SPTR: Phosphatase
FT                   family protein; PFAM: Calcineurin-like phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79638"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBA8"
FT                   /protein_id="ADK79638.1"
FT                   /translation="MKILVLSDIHGNREALETVLSECEGEYQQIWCLGDIVGYGPDPND
FT                   CIEILAGKEVVAVMGNHDLGAGRGEKWDLFSPVARTMIEWTAERLSGQSRHYLSKLPEI
FT                   AYRDGYTLVHGSPAGPVWRYILDGHSAAEAFSLMDTPACLYGHTHVPALFSLSKRALRY
FT                   HQPRYGKRMRPPGQMWLANPGSCGIPRDGDGRAAFILLDTESGFFTFRRIVYPKNRTVE
FT                   KLKRLGAPYQLIQLLQSDI"
     MKILVLSDIH GNREALETVL SECEGEYQQI WCLGDIVGYG PDPNDCIEIL AGKEVVAVMG        60
     NHDLGAGRGE KWDLFSPVAR TMIEWTAERL SGQSRHYLSK LPEIAYRDGY TLVHGSPAGP       120
     VWRYILDGHS AAEAFSLMDT PACLYGHTHV PALFSLSKRA LRYHQPRYGK RMRPPGQMWL       180
     ANPGSCGIPR DGDGRAAFIL LDTESGFFTF RRIVYPKNRT VEKLKRLGAP YQLIQLLQSD       240
     I                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page