(data stored in ACNUC7421 zone)

EMBL: CP002116.PE481

CP002116.PE481       Location/Qualifiers
FT   CDS             complement(509028..510341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0494"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="COGs: COG2204 Response regulator containing
FT                   CheY-like receiver AAA-type ATPase and DNA-binding domains;
FT                   InterProIPR001789:IPR003593:IPR020441:IPR002078:IPR 002197;
FT                   KEGG: aoe:Clos_1079 two component, sigma54 specific, Fis
FT                   family transcriptional regulator; PFAM: sigma-54 factor
FT                   interaction domain-containing protein; response regulator
FT                   receiver; helix-turn-helix Fis-type; SMART: response
FT                   regulator receiver; AAA ATPase; SPTR: Two component,
FT                   sigma54 specific, transcriptional regulator, Fis family;
FT                   PFAM: Response regulator receiver domain; Bacterial
FT                   regulatory protein, Fis family; Sigma-54 interaction
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79641"
FT                   /db_xref="GOA:E1RBB1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBB1"
FT                   /protein_id="ADK79641.1"
FT                   /translation="MYTILLVDDEKNLRTSIAHFFSLEGIETEEASNGLAAQQLLMKHH
FT                   FDAVITDLKMPGMNGLELLEWIGESGPDIPVFMISAFGEVEDAVQAMKKGAVDYVVKPF
FT                   DPEELILRLRRELERRKLQKLTNTIPTDDDYTGESPAMRQLFSLARKVAPTASNVLITG
FT                   ESGTGKEVMARFLHNHSDRSKNNFQAVNLGGIPESLMESELFGYEKGSFTGADHRKIGY
FT                   FEASNGGTIFLDEVGEAPLALQVKLLRVLQEKAVTRVGGTGTIPLDIRIIAATNKDLDA
FT                   MVKARDFRDDLYYRLNVIHLQLPALRERREDIPFLAETFRSKFASSMGKTITGFSDDAM
FT                   KALQHYSFPGNIRELENMVERAMILAEPPLLERKDFPLHQEEGPQTPKGSLRELEREAI
FT                   LEALLRNNGHREKSAAELGITRRTLLNKINEYGISIPE"
     MYTILLVDDE KNLRTSIAHF FSLEGIETEE ASNGLAAQQL LMKHHFDAVI TDLKMPGMNG        60
     LELLEWIGES GPDIPVFMIS AFGEVEDAVQ AMKKGAVDYV VKPFDPEELI LRLRRELERR       120
     KLQKLTNTIP TDDDYTGESP AMRQLFSLAR KVAPTASNVL ITGESGTGKE VMARFLHNHS       180
     DRSKNNFQAV NLGGIPESLM ESELFGYEKG SFTGADHRKI GYFEASNGGT IFLDEVGEAP       240
     LALQVKLLRV LQEKAVTRVG GTGTIPLDIR IIAATNKDLD AMVKARDFRD DLYYRLNVIH       300
     LQLPALRERR EDIPFLAETF RSKFASSMGK TITGFSDDAM KALQHYSFPG NIRELENMVE       360
     RAMILAEPPL LERKDFPLHQ EEGPQTPKGS LRELEREAIL EALLRNNGHR EKSAAELGIT       420
     RRTLLNKINE YGISIPE                                                      437
//

If you have problems or comments...

PBIL Back to PBIL home page