(data stored in ACNUC7421 zone)

EMBL: CP002116.PE49

CP002116.PE49        Location/Qualifiers
FT   CDS             complement(51724..53061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0049"
FT                   /product="amino acid permease-associated region"
FT                   /note="COGs: COG1113 Gamma-aminobutyrate permease and
FT                   related permease; InterPro IPR004841:IPR002293; KEGG:
FT                   mem:Memar_1826 amino acid permease-associated region; PFAM:
FT                   amino acid permease-associated region; SPTR: Amino acid
FT                   permease-associated region; PFAM: Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79209"
FT                   /db_xref="GOA:E1R6S7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6S7"
FT                   /protein_id="ADK79209.1"
FT                   /translation="MSQKGTGLHRELGILDVTAITSGIIIGAGVFIVTGIAAQFAGSLT
FT                   WLAYAIGAIPVILVGISTIFLNLMHPVEGGESYVYPTRIVSKPLGFLSGWGMWLAVIGP
FT                   IAITAQAFINYLNALPGTSVVFPATIGAVVVTILFSLINWVGLKTVKIVQNVLFLFMVA
FT                   GILIYIILALPHMKGTNITMGSPLGFAGVMKATSLLLFSYAGLTLAADLGEEAKNPAKT
FT                   ITWGIILGILIPTLLYVVSAFVSTAVLPWKDFAASEAPYAAVASTFMGPFGVVFIVIVA
FT                   WAAILSSHNGEQAVAARVFFGLSRDGILGGKTASVNRFGTPTFGLIATSVLAIILIISG
FT                   TIQLVAEIIVAMFLYNWIITHIAVLMARKKFPELVDKLPGIYRKKGFLCLPVLGLAVSV
FT                   YLLILQGWKALLYAAVWMIVGYLVYLVGISRNKKEILSRMDRWPES"
     MSQKGTGLHR ELGILDVTAI TSGIIIGAGV FIVTGIAAQF AGSLTWLAYA IGAIPVILVG        60
     ISTIFLNLMH PVEGGESYVY PTRIVSKPLG FLSGWGMWLA VIGPIAITAQ AFINYLNALP       120
     GTSVVFPATI GAVVVTILFS LINWVGLKTV KIVQNVLFLF MVAGILIYII LALPHMKGTN       180
     ITMGSPLGFA GVMKATSLLL FSYAGLTLAA DLGEEAKNPA KTITWGIILG ILIPTLLYVV       240
     SAFVSTAVLP WKDFAASEAP YAAVASTFMG PFGVVFIVIV AWAAILSSHN GEQAVAARVF       300
     FGLSRDGILG GKTASVNRFG TPTFGLIATS VLAIILIISG TIQLVAEIIV AMFLYNWIIT       360
     HIAVLMARKK FPELVDKLPG IYRKKGFLCL PVLGLAVSVY LLILQGWKAL LYAAVWMIVG       420
     YLVYLVGISR NKKEILSRMD RWPES                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page