(data stored in ACNUC7421 zone)

EMBL: CP002116.PE491

CP002116.PE491       Location/Qualifiers
FT   CDS             complement(519484..520533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0504"
FT                   /product="inner-membrane translocator"
FT                   /note="COGs: COG1172 Ribose/xylose/arabinose/galactoside
FT                   ABC-type transport systems permease components; InterPro
FT                   IPR001851; KEGG: tai:Taci_0122 inner-membrane translocator;
FT                   PFAM: inner-membrane translocator; SPTR: Inner-membrane
FT                   translocator; PFAM: Branched-chain amino acid transport
FT                   system / permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79651"
FT                   /db_xref="GOA:E1RBC1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBC1"
FT                   /protein_id="ADK79651.1"
FT                   /translation="MESIRTFIERVGWPRIIIAIFLFTLFIAAPFVEVKVSTSISDTLI
FT                   RFGMNGVMVLAMVPMVQSGCGLNFGLPLGIISGLLGAVLTIELGITGFPAFLTAIAITT
FT                   PFALLFGFGYGKLLNRVKGNEMVIATYVGFSSVAFMCIMWLLLPLKSPTMVWGYGGEGL
FT                   RTTISTEGFYLHVLNDFLAVHIGKDFSFPTGMILFLAVICLFVWAFFHTKTGTAMTAVG
FT                   SNPDYARAAGISVDKMRTISVMMSTWLGGVGILVYQQSFGFIQLYMGPFYMAFPAVAAI
FT                   LIGGASVHKASIYNVLIGTFLFQGILTMTPSVMNSIINTDMSEVIRIIVSNGMILYALT
FT                   RVTRSGSRG"
     MESIRTFIER VGWPRIIIAI FLFTLFIAAP FVEVKVSTSI SDTLIRFGMN GVMVLAMVPM        60
     VQSGCGLNFG LPLGIISGLL GAVLTIELGI TGFPAFLTAI AITTPFALLF GFGYGKLLNR       120
     VKGNEMVIAT YVGFSSVAFM CIMWLLLPLK SPTMVWGYGG EGLRTTISTE GFYLHVLNDF       180
     LAVHIGKDFS FPTGMILFLA VICLFVWAFF HTKTGTAMTA VGSNPDYARA AGISVDKMRT       240
     ISVMMSTWLG GVGILVYQQS FGFIQLYMGP FYMAFPAVAA ILIGGASVHK ASIYNVLIGT       300
     FLFQGILTMT PSVMNSIINT DMSEVIRIIV SNGMILYALT RVTRSGSRG                   349
//

If you have problems or comments...

PBIL Back to PBIL home page