(data stored in ACNUC7421 zone)

EMBL: CP002116.PE5

CP002116.PE5         Location/Qualifiers
FT   CDS             3965..4435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0005"
FT                   /product="protein of unknown function DUF721"
FT                   /note="InterPro IPR007922; KEGG: vpr:Vpar_0005 protein of
FT                   unknown function DUF721; PFAM: protein of unknown function
FT                   DUF721; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function (DUF721)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79165"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6N3"
FT                   /protein_id="ADK79165.1"
FT                   /translation="MKKASEILSQFFDQAQLEKAQKYSSFFRSWRTIVGIDIASHTRVR
FT                   EIERDVLIVEADHPGWAQMIELKKRRILRDINKKYPEFSLSNIRVWIVQQLGAVYPVER
FT                   EEGNRNEWHYEPPVFGEKEKNERKSAGDDGRLQQMLDSIGKMVKGSERDNRH"
     MKKASEILSQ FFDQAQLEKA QKYSSFFRSW RTIVGIDIAS HTRVREIERD VLIVEADHPG        60
     WAQMIELKKR RILRDINKKY PEFSLSNIRV WIVQQLGAVY PVEREEGNRN EWHYEPPVFG       120
     EKEKNERKSA GDDGRLQQML DSIGKMVKGS ERDNRH                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page