(data stored in ACNUC7421 zone)

EMBL: CP002116.PE50

CP002116.PE50        Location/Qualifiers
FT   CDS             complement(53132..55048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0050"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG1032 Fe-S oxidoreductase; InterPro
FT                   IPR006638:IPR013704:IPR007197; KEGG: cth:Cthe_1094
FT                   hypothetical protein; PFAM: Radical SAM domain protein;
FT                   Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB; SPTR: Radical SAM-like protein; PFAM: Domain
FT                   of unknown function (DUF3362); Radical SAM superfamily;
FT                   Radical SAM N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79210"
FT                   /db_xref="GOA:E1R6S8"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013704"
FT                   /db_xref="InterPro:IPR022946"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR024560"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6S8"
FT                   /protein_id="ADK79210.1"
FT                   /translation="MTPVYSIGFLLYSSAMHKNHAEFLPLTKQEFEAQHGTASPDFIIV
FT                   SGDAYVDHPSFGTALIGRLLESRGYRVAIIAQPDWRNTEDFSRFGRPRLAFLVTSGNLD
FT                   SMVANYSASRHPRREDAYSPGGKAGLRPDRSLVVYTSRIRQAFKGVTVALGGLEASLRS
FT                   LSHYDYWSDTIRRSVLLDAKADYLLYGMSETTILALAAALETAVEKGSQPNVETIRGLV
FT                   RVVGKNNIAYDNIISSQYDDITGSKTVFLPSHEALIKDGTRYADHFALQMKHADPYSAA
FT                   TLIEPCGDRFIVHNPPPFPLTTEELDAVYELPFCRRAHPSYAKAGGIPALQEVRFSLVS
FT                   SRGCFGGCSFCALTFHQGRIITPRSKESLLREAQKLIADPDFKGYIHDVGGPTANFHTP
FT                   ACEGQKHRGACSNRQCLFPKPCPSLKVDHTAYLDVLKSLRKLPGVKKVFIRSGIRFDYL
FT                   LLDENRSFLKELVAYHISGQLKVAPEHAGSRTLEAMGKPPIEVYEQFSRLFYEETKRIG
FT                   KKQYLIPYLIAGHPGSTLDEAVELALFLKKSGFIPDQVQDFYPTPGTLSTCMWATGIDP
FT                   RTMKPIFVPRGEKERHLQRALLQFNRPKNYDRVRKALRQAGRSDLIGFGQTALVPPERN
FT                   RHP"
     MTPVYSIGFL LYSSAMHKNH AEFLPLTKQE FEAQHGTASP DFIIVSGDAY VDHPSFGTAL        60
     IGRLLESRGY RVAIIAQPDW RNTEDFSRFG RPRLAFLVTS GNLDSMVANY SASRHPRRED       120
     AYSPGGKAGL RPDRSLVVYT SRIRQAFKGV TVALGGLEAS LRSLSHYDYW SDTIRRSVLL       180
     DAKADYLLYG MSETTILALA AALETAVEKG SQPNVETIRG LVRVVGKNNI AYDNIISSQY       240
     DDITGSKTVF LPSHEALIKD GTRYADHFAL QMKHADPYSA ATLIEPCGDR FIVHNPPPFP       300
     LTTEELDAVY ELPFCRRAHP SYAKAGGIPA LQEVRFSLVS SRGCFGGCSF CALTFHQGRI       360
     ITPRSKESLL REAQKLIADP DFKGYIHDVG GPTANFHTPA CEGQKHRGAC SNRQCLFPKP       420
     CPSLKVDHTA YLDVLKSLRK LPGVKKVFIR SGIRFDYLLL DENRSFLKEL VAYHISGQLK       480
     VAPEHAGSRT LEAMGKPPIE VYEQFSRLFY EETKRIGKKQ YLIPYLIAGH PGSTLDEAVE       540
     LALFLKKSGF IPDQVQDFYP TPGTLSTCMW ATGIDPRTMK PIFVPRGEKE RHLQRALLQF       600
     NRPKNYDRVR KALRQAGRSD LIGFGQTALV PPERNRHP                               638
//

If you have problems or comments...

PBIL Back to PBIL home page