(data stored in ACNUC7421 zone)

EMBL: CP002116.PE506

CP002116.PE506       Location/Qualifiers
FT   CDS             539274..539981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0520"
FT                   /product="GntR domain protein"
FT                   /note="COGs: COG2186 Transcriptional regulators; InterPro
FT                   IPR000524:IPR008920:IPR011711; KEGG: cpy:Cphy_1561
FT                   regulatory protein GntR HTH; PFAM: GntR domain protein;
FT                   regulatory protein GntR HTH; fatty acid responsive
FT                   transcription factor FadR domain protein; SMART: regulatory
FT                   protein GntR HTH; SPTR: Transcriptional regulator, GntR
FT                   family; PFAM: Bacterial regulatory proteins, gntR family;
FT                   FCD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79666"
FT                   /db_xref="GOA:E1RBD6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBD6"
FT                   /protein_id="ADK79666.1"
FT                   /translation="MGDCIPRKAKSLKEQCINYLEERIISGDFPSGHRLPSERALAGML
FT                   RVSRPVVHESVVELSNRGFITILPRRGCIVNDFRTTGSSELLSSLFRYASGSLRPDILS
FT                   GMAEMRLLFETEMARLAALRRSNEGIVRLKAALRQEVKVAESVDWRGKVIAEADYAFHH
FT                   AIALAGENIVYQMLMNSFRTLYLNVLSRFYGKRFDLRPILDKHRALLANIVEGKGEDAA
FT                   WEMKGLLTMNKAV"
     MGDCIPRKAK SLKEQCINYL EERIISGDFP SGHRLPSERA LAGMLRVSRP VVHESVVELS        60
     NRGFITILPR RGCIVNDFRT TGSSELLSSL FRYASGSLRP DILSGMAEMR LLFETEMARL       120
     AALRRSNEGI VRLKAALRQE VKVAESVDWR GKVIAEADYA FHHAIALAGE NIVYQMLMNS       180
     FRTLYLNVLS RFYGKRFDLR PILDKHRALL ANIVEGKGED AAWEMKGLLT MNKAV            235
//

If you have problems or comments...

PBIL Back to PBIL home page