(data stored in ACNUC7421 zone)

EMBL: CP002116.PE51

CP002116.PE51        Location/Qualifiers
FT   CDS             complement(55045..55689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0051"
FT                   /product="deoxynucleoside kinase"
FT                   /note="COGs: COG1428 Deoxynucleoside kinase; InterPro
FT                   IPR002624; KEGG: dge:Dgeo_0101 deoxynucleoside kinase;
FT                   PFAM: deoxynucleoside kinase; SPTR: Deoxynucleoside kinase;
FT                   PFAM: Deoxynucleoside kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79211"
FT                   /db_xref="GOA:E1R6S9"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6S9"
FT                   /protein_id="ADK79211.1"
FT                   /translation="MKKYVVLAGNIGAGKSTLVRKLADRLGFRPYYEPVTENPYLKDFY
FT                   SDMRRWAFHSQTFFLTHRVRTHHLLAEDPFSVVQDRSMYEDAEVFARNLYEQQSMTKRD
FT                   WETYQELYHTLITMLPPPDLIVYLRASVTTLKKRIALRGRNFEASISDTYLQGLNRLYD
FT                   RWTNDFTLAPILIVPTDRLDFVEQNKDFEAIVKTIEQRLLDKQGILFPVGM"
     MKKYVVLAGN IGAGKSTLVR KLADRLGFRP YYEPVTENPY LKDFYSDMRR WAFHSQTFFL        60
     THRVRTHHLL AEDPFSVVQD RSMYEDAEVF ARNLYEQQSM TKRDWETYQE LYHTLITMLP       120
     PPDLIVYLRA SVTTLKKRIA LRGRNFEASI SDTYLQGLNR LYDRWTNDFT LAPILIVPTD       180
     RLDFVEQNKD FEAIVKTIEQ RLLDKQGILF PVGM                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page