(data stored in ACNUC7421 zone)

EMBL: CP002116.PE52

CP002116.PE52        Location/Qualifiers
FT   CDS             complement(55750..56901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0052"
FT                   /product="transcriptional regulator, GntR family with LacI
FT                   sensor"
FT                   /note="COGs: COG1609 Transcriptional regulators; InterPro
FT                   IPR000524:IPR001761; KEGG: aca:ACP_0022 transcriptional
FT                   regulator, GntR family; PFAM: regulatory protein GntR HTH;
FT                   periplasmic binding protein/LacI transcriptional regulator;
FT                   SMART: regulatory protein GntR HTH; SPTR: Transcriptional
FT                   regulator, GntR family; PFAM: Bacterial regulatory
FT                   proteins, gntR family; family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79212"
FT                   /db_xref="GOA:E1R6T0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6T0"
FT                   /protein_id="ADK79212.1"
FT                   /translation="MTNKVERMQFKYQYIYDKLRNLLENGRYHAGDRLPTEVELASRFN
FT                   VSRPTVTRALNALQEEGIIVRKTGSGSFVNNLHSYKNKFNNRIFGLLVPGLGKGEIFEP
FT                   ICTQIAANAEKNQCSLLWSGSEIRTTEAAKSLVDVTQRYIAHHIAGVFFEPLELSPSFD
FT                   QINRKIISMFQDAGIPIVLIDSDYLPFPERSNLDLVGIDNFRAAYMATRHYLRHGEKRI
FT                   DFLARPYSAYTISIRLRGYRTALIDYGIIPQAEWIHLVNPEELEYITSRFDHPEAPPFN
FT                   MICANDETASALLGACESVGISVPEHLRIVGFDDVHYAQMLRVPLTTIHQSVQQIGNLA
FT                   LETLLWRIEHPDAPARTINAETRMIIRESCGMTGKAEISPFYS"
     MTNKVERMQF KYQYIYDKLR NLLENGRYHA GDRLPTEVEL ASRFNVSRPT VTRALNALQE        60
     EGIIVRKTGS GSFVNNLHSY KNKFNNRIFG LLVPGLGKGE IFEPICTQIA ANAEKNQCSL       120
     LWSGSEIRTT EAAKSLVDVT QRYIAHHIAG VFFEPLELSP SFDQINRKII SMFQDAGIPI       180
     VLIDSDYLPF PERSNLDLVG IDNFRAAYMA TRHYLRHGEK RIDFLARPYS AYTISIRLRG       240
     YRTALIDYGI IPQAEWIHLV NPEELEYITS RFDHPEAPPF NMICANDETA SALLGACESV       300
     GISVPEHLRI VGFDDVHYAQ MLRVPLTTIH QSVQQIGNLA LETLLWRIEH PDAPARTINA       360
     ETRMIIRESC GMTGKAEISP FYS                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page