(data stored in ACNUC7421 zone)

EMBL: CP002116.PE520

CP002116.PE520       Location/Qualifiers
FT   CDS             complement(552472..555630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0534"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR000014:IPR001610:IPR003661:IPR003594:IPR
FT                   004358:IPR013767:IPR013655:IPR005467:IPR000700; KEGG:
FT                   mgm:Mmc1_2953 multi-sensor hybrid histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; PAS fold-3 domain protein; PAS fold
FT                   domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; PAS domain
FT                   containing protein; PAC repeat-containing protein; SPTR:
FT                   Sensor protein; TIGRFAM: PAS sensor protein; PFAM:
FT                   Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase;
FT                   His Kinase A (phosphoacceptor) domain; PAS fold; TIGRFAM:
FT                   PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79680"
FT                   /db_xref="GOA:E1RBF0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBF0"
FT                   /protein_id="ADK79680.1"
FT                   /translation="MTMPKPLIITLRKSLYPFIFGSILALLVTIIPLQTLTAYRFHRDQ
FT                   QKIVTATIASTIQKYLTVADTSLTFLSKQPTERMNDHLTSFQESFKIFSKIAFADTDGT
FT                   VVAANSKIQAHQDVSNLLHEAVPTPGLTSLSTGPIISPHTGKLCIFLVHPLEGQGNIIA
FT                   ELNNNYLFDQMMQTIGMVNIENLVFVTDQSGNLLLHPDPRLLQQKANWGDLPVIHDIRQ
FT                   NDGETSAFVSIGERLYIAVARSIPETHWILTYAVPISATALEIIGSLVLTTLLFLFFIG
FT                   SVLIILKRTLENNIVRPLTQMQHIIEQSVIEKTPQTIGVIANSFSELETMRKVFNRLSK
FT                   TIRQKTLSLIEFKRAVREAGHAIYMTDREGIITYTNPAFERITGYSWEEAEGKTPNILN
FT                   SGMMPESYFARLWESILAGELWEEEIINRKQDGTIYYAHQTIAPIFSDFGMVISFVAIQ
FT                   NDVTQQRESERRLWESETLYRNLFETAADSILLINPETLGISECNQATIESLGYGKDEI
FT                   KQLSYLDIQPPDHQQRVKELVQGISEFDQATFDTQHTTKTGELREVNVHMTLLNLDQRK
FT                   LLLAIMHDVTERRQAERTIQQSERKYRMLAENSSDMISQHAPGGIYLYVSPACIRLLGY
FT                   EQEELLGRQVEEIIHPEDIERVIEIGKNHLGSPSERITTLVYRIQKKDGSYTWFETHSR
FT                   RTDSQEIIAISRDISERIAMERGLEEANKAKSMFLANMSHEIRTPLNAVLGFNDLIARN
FT                   TSDPKLKEYAAQIDLSGKNLLTLIGDILDFSKVEAGGVQFNYDFFSPHHLVREIIALFE
FT                   MEAKKRGIDLITKERTPIPKQIKLDEDRVRQILINLVSNALKFTEKGSVCLEIHAAYIK
FT                   QKDQRCNLTFSVIDTGIGIPEKEQHVIFEAFRQQEGQSTRKYGGTGLGLAISKNLAEGM
FT                   EGSIDVKSNVGSGSTFTLSFDSVEWRSADDEEGALQPDEKHRKEHDSKRQSSIVLPASL
FT                   QKQWEAVRLVRAIDEIADFAELLKREASKEEHPELIDFANQLERACDELDIEEIEYLLE
FT                   KTGP"
     MTMPKPLIIT LRKSLYPFIF GSILALLVTI IPLQTLTAYR FHRDQQKIVT ATIASTIQKY        60
     LTVADTSLTF LSKQPTERMN DHLTSFQESF KIFSKIAFAD TDGTVVAANS KIQAHQDVSN       120
     LLHEAVPTPG LTSLSTGPII SPHTGKLCIF LVHPLEGQGN IIAELNNNYL FDQMMQTIGM       180
     VNIENLVFVT DQSGNLLLHP DPRLLQQKAN WGDLPVIHDI RQNDGETSAF VSIGERLYIA       240
     VARSIPETHW ILTYAVPISA TALEIIGSLV LTTLLFLFFI GSVLIILKRT LENNIVRPLT       300
     QMQHIIEQSV IEKTPQTIGV IANSFSELET MRKVFNRLSK TIRQKTLSLI EFKRAVREAG       360
     HAIYMTDREG IITYTNPAFE RITGYSWEEA EGKTPNILNS GMMPESYFAR LWESILAGEL       420
     WEEEIINRKQ DGTIYYAHQT IAPIFSDFGM VISFVAIQND VTQQRESERR LWESETLYRN       480
     LFETAADSIL LINPETLGIS ECNQATIESL GYGKDEIKQL SYLDIQPPDH QQRVKELVQG       540
     ISEFDQATFD TQHTTKTGEL REVNVHMTLL NLDQRKLLLA IMHDVTERRQ AERTIQQSER       600
     KYRMLAENSS DMISQHAPGG IYLYVSPACI RLLGYEQEEL LGRQVEEIIH PEDIERVIEI       660
     GKNHLGSPSE RITTLVYRIQ KKDGSYTWFE THSRRTDSQE IIAISRDISE RIAMERGLEE       720
     ANKAKSMFLA NMSHEIRTPL NAVLGFNDLI ARNTSDPKLK EYAAQIDLSG KNLLTLIGDI       780
     LDFSKVEAGG VQFNYDFFSP HHLVREIIAL FEMEAKKRGI DLITKERTPI PKQIKLDEDR       840
     VRQILINLVS NALKFTEKGS VCLEIHAAYI KQKDQRCNLT FSVIDTGIGI PEKEQHVIFE       900
     AFRQQEGQST RKYGGTGLGL AISKNLAEGM EGSIDVKSNV GSGSTFTLSF DSVEWRSADD       960
     EEGALQPDEK HRKEHDSKRQ SSIVLPASLQ KQWEAVRLVR AIDEIADFAE LLKREASKEE      1020
     HPELIDFANQ LERACDELDI EEIEYLLEKT GP                                    1052
//

If you have problems or comments...

PBIL Back to PBIL home page