(data stored in ACNUC7421 zone)

EMBL: CP002116.PE521

CP002116.PE521       Location/Qualifiers
FT   CDS             555701..556717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0535"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="COGs: COG2334 Putative homoserine kinase type II
FT                   (protein kinase fold); InterPro IPR002575; KEGG: dps:DP2064
FT                   hypothetical protein; PFAM: aminoglycoside
FT                   phosphotransferase; SPTR: Aminoglycoside
FT                   phosphotransferase; PFAM: Phosphotransferase enzyme family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79681"
FT                   /db_xref="GOA:E1RBF1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBF1"
FT                   /protein_id="ADK79681.1"
FT                   /translation="MENEKPPAGIFDYIEPDGIISAVEISYGINLDGTWSAFPSYVNRV
FT                   YGLRDEDGNRYVVKLYRPGRWSVSAIEEEHGFLLECAAEEVPVVAPLSGVDGRTLHFLE
FT                   CPAISGSYPFALFPLRSGRLFETDRDEDYLRIGSLIGRLHRISRQGKAHVRQEWLPSLS
FT                   KNHLEMLLEQNLVSSSLRRHFEGLCLHCIETIEPLFSHQPLLRLHGDCHRGNILERPGE
FT                   GLMLIDFDDMSNGPAVQDLWLLLPDRIGACEYQFSLLQEGYGQFSALSPGSALLIEPLR
FT                   FMRMLHYLAWTAHQQCDHDFSLRHPQWGSEAFWIRELADFEEQFDYIRKILDSSYTG"
     MENEKPPAGI FDYIEPDGII SAVEISYGIN LDGTWSAFPS YVNRVYGLRD EDGNRYVVKL        60
     YRPGRWSVSA IEEEHGFLLE CAAEEVPVVA PLSGVDGRTL HFLECPAISG SYPFALFPLR       120
     SGRLFETDRD EDYLRIGSLI GRLHRISRQG KAHVRQEWLP SLSKNHLEML LEQNLVSSSL       180
     RRHFEGLCLH CIETIEPLFS HQPLLRLHGD CHRGNILERP GEGLMLIDFD DMSNGPAVQD       240
     LWLLLPDRIG ACEYQFSLLQ EGYGQFSALS PGSALLIEPL RFMRMLHYLA WTAHQQCDHD       300
     FSLRHPQWGS EAFWIRELAD FEEQFDYIRK ILDSSYTG                               338
//

If you have problems or comments...

PBIL Back to PBIL home page