(data stored in ACNUC7421 zone)

EMBL: CP002116.PE53

CP002116.PE53        Location/Qualifiers
FT   CDS             57132..58085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0053"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="COGs: COG1879 ABC-type sugar transport system
FT                   periplasmic component; InterPro IPR001761; KEGG:
FT                   eok:G2583_4914 putative periplasmic ribose-binding protein
FT                   of ABC transport system; PFAM: periplasmic binding
FT                   protein/LacI transcriptional regulator; SPTR: Putative
FT                   carbohydrate binding protein; PFAM: family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79213"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6T1"
FT                   /protein_id="ADK79213.1"
FT                   /translation="MRKVVLILLCGMLLGGTLFAGGQGEGEKVLQVAATFGDLGNPFFF
FT                   TMGKGVEDAAKAIDPNAKVTVQSSGYDLNTQTSQMENFIANGVDIIILNAADTAGIAPA
FT                   VRKAKEAGIIVVAADVNADGGVDATVTSNNYQAGTQAGEYIVKRLGGKGNIVIINGPPV
FT                   SAVIDRVNGAKEVLAKNPGIKILSDNQNAGGNREGGLRVMTDLLTAYDNIDAVFAINDP
FT                   TGIGADLAIKQAKRGDEMFVVGVDGAPDAVVALNDTNSSFVATPSQDPYTMATRAVQVA
FT                   YEVIQGNPPKEKLILIPTTLITRDNVSEYKGWTEPE"
     MRKVVLILLC GMLLGGTLFA GGQGEGEKVL QVAATFGDLG NPFFFTMGKG VEDAAKAIDP        60
     NAKVTVQSSG YDLNTQTSQM ENFIANGVDI IILNAADTAG IAPAVRKAKE AGIIVVAADV       120
     NADGGVDATV TSNNYQAGTQ AGEYIVKRLG GKGNIVIING PPVSAVIDRV NGAKEVLAKN       180
     PGIKILSDNQ NAGGNREGGL RVMTDLLTAY DNIDAVFAIN DPTGIGADLA IKQAKRGDEM       240
     FVVGVDGAPD AVVALNDTNS SFVATPSQDP YTMATRAVQV AYEVIQGNPP KEKLILIPTT       300
     LITRDNVSEY KGWTEPE                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page