(data stored in ACNUC7421 zone)

EMBL: CP002116.PE531

CP002116.PE531       Location/Qualifiers
FT   CDS             566167..567402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0546"
FT                   /product="putative signal transduction histidine kinase"
FT                   /note="COGs: COG4585 Signal transduction histidine kinase;
FT                   InterPro IPR003594; KEGG: cac:CAC0864 histidine kinase-like
FT                   ATPase; PFAM: ATP-binding region ATPase domain protein;
FT                   SPTR: Histidine kinase-like ATPase; PFAM: Histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79691"
FT                   /db_xref="GOA:E1RBG1"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBG1"
FT                   /protein_id="ADK79691.1"
FT                   /translation="MGAMHEKKMERERLFAIFLIGVSLLSHMGAGLFFGVQEQHVDYLR
FT                   IHWHLPFYLLLAISAVLSILINLKIDSGKKQVILLIDVLLFFLIGYPLGPHLDIEIILG
FT                   INLITILVFSFSDLYGEKIALIIIVVTLMLQAPYSLWFTQVPAPSMENMIFAAFILVVF
FT                   TLFLSILKRVMNRLHHEEIRSRKYNRALDELTNNSFDYQHISRQNAMELIRTEKQYITR
FT                   EVHDIISYAMTNQLMLVQAAMSIKDKNSPVVDELLEKAKNEINGGMSKTRAALGELRDQ
FT                   EFDQEDVNLLVEQLIAKFKNFSHIDVQFRKDEFFSRLPRAYNQTIFHIIQQCMTNTYLH
FT                   SSADTIEILCEHEGRCVVVVVKDNGTNSRGFREGIGIKGMRERIEMLGGVLKISALSLG
FT                   FTVRAEIPIAEG"
     MGAMHEKKME RERLFAIFLI GVSLLSHMGA GLFFGVQEQH VDYLRIHWHL PFYLLLAISA        60
     VLSILINLKI DSGKKQVILL IDVLLFFLIG YPLGPHLDIE IILGINLITI LVFSFSDLYG       120
     EKIALIIIVV TLMLQAPYSL WFTQVPAPSM ENMIFAAFIL VVFTLFLSIL KRVMNRLHHE       180
     EIRSRKYNRA LDELTNNSFD YQHISRQNAM ELIRTEKQYI TREVHDIISY AMTNQLMLVQ       240
     AAMSIKDKNS PVVDELLEKA KNEINGGMSK TRAALGELRD QEFDQEDVNL LVEQLIAKFK       300
     NFSHIDVQFR KDEFFSRLPR AYNQTIFHII QQCMTNTYLH SSADTIEILC EHEGRCVVVV       360
     VKDNGTNSRG FREGIGIKGM RERIEMLGGV LKISALSLGF TVRAEIPIAE G                411
//

If you have problems or comments...

PBIL Back to PBIL home page