(data stored in ACNUC7421 zone)

EMBL: CP002116.PE532

CP002116.PE532       Location/Qualifiers
FT   CDS             567402..568073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0547"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="COGs: COG2197 Response regulator containing a
FT                   CheY-like receiver domain and an HTH DNA-binding domain;
FT                   InterPro IPR001789:IPR000792; KEGG: cac:CAC0865
FT                   two-component response regulator; PFAM: response regulator
FT                   receiver; regulatory protein LuxR; SMART: response
FT                   regulator receiver; regulatory protein LuxR; SPTR: Response
FT                   regulator; PFAM: Response regulator receiver domain;
FT                   Bacterial regulatory proteins, luxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79692"
FT                   /db_xref="GOA:E1RBG2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:E1RBG2"
FT                   /protein_id="ADK79692.1"
FT                   /translation="MVVDTVRVLLVDDQLLFLESLKIVLENLSEEIEVCGLASSGHEAI
FT                   SLAATCRPDVILMDVSMPEMDGIEASARIKAERPDVNIIMLTTFEEKGKVQEAIKLGIN
FT                   GYLLKNLKPELLIQYILLSAEGGVFLSTEVADRLCRQGGDEKAGDEQAERCLDEEDSSY
FT                   KFLTRREKEVLKYLAMDMTNMEIAEKIHVGYQTIRNYISVIYSKLNVSNRMEVIKKIQE
FT                   L"
     MVVDTVRVLL VDDQLLFLES LKIVLENLSE EIEVCGLASS GHEAISLAAT CRPDVILMDV        60
     SMPEMDGIEA SARIKAERPD VNIIMLTTFE EKGKVQEAIK LGINGYLLKN LKPELLIQYI       120
     LLSAEGGVFL STEVADRLCR QGGDEKAGDE QAERCLDEED SSYKFLTRRE KEVLKYLAMD       180
     MTNMEIAEKI HVGYQTIRNY ISVIYSKLNV SNRMEVIKKI QEL                         223
//

If you have problems or comments...

PBIL Back to PBIL home page